Identifiers and Description

Gene Model Identifier

TTHERM_00239130

Standard Name

MSC1 (Membrane Solute Carrier)

Aliases

PreTt18851 | 20.m00315 | 3706.m00081

Description

hypothetical protein

Genome Browser (Macronucleus)

GBrowse

Genome Browser (Micronucleus)

GBrowse

Gene Ontology Annotations

No Data fetched for Gene Ontology Annotations

Domains

  • ( PF08449 ) UAA transporter family
  • ( TIGR00803 ) UDP-galactose transporter
  • ( TIGR02614 ) cell division protein FtsW
  • ( PF00892 ) Integral membrane protein DUF6
  • ( PF03596 ) cadmium resistance transporter
  • ( PF03151 ) Domain of unknown function, DUF250
  • ( PF04018 ) Domain of unknown function (DUF368)
  • ( PF07690 ) transporter, major facilitator family
  • ( TIGR00950 ) Carboxylate/Amino Acid/Amine Transporter
  • ( TIGR01974 ) proton-translocating NADH-quinone oxidoreductase, chain L

Gene Expression Profile

  • Tetrahymena Functional Genomics Database:

Change in Gene Expression

TMHMM

TMHMM

Signal Peptide

Signal Peptide Present?: No
Presense Probability: 18.3%

TetraMine Data

TTHERM_00239130

WebApollo

Fullscreen View

Tetrahymena Stock Center

No Data fetched for StockID

Homologs (v.2006 protein sequences)

SourceIdentifierScoreDescription
Tetrahymena borealisEI9_07886.12.0004460046616782e-163hypothetical protein (374 aa)
DictyBaseDDB_G02889298.001824328206442e-49DDB_G0288929 on chromosome: 5
position 2135701 to 2137186
WormBaseWBGene000137403.000842737734004e-34locus:hut-1 status:Confirmed
UniProt:Q9BHL2 protein_id
:CAC35849.1
OxytrichaContig14380.0.g928.997017754360629e-34UAA transporter family
SGDYPL244C3.000555717977434e-27HUT1 Protein with a role in UD
P-galactose transport to the G
olgi lumen, has similarity to
human UDP-galactose transporte
r UGTrel1, exhibits a genetic
interaction with S. cerevisiae
ERO1
Stentor CoeruleusSteCoe_351542.3195228302435696e-16

General Information

Paragraph NoGene NameParagraph Text
38MSC1Tetrahymena thermophilia MSC1 has similarities with different protein solute carriers from bacterial organisms. It contains only one domain characteristic to UAA transporters, which has a specificity for UDP-N-acetylglucosamine. The protein is largely located on the membrane of the eukaryote. Investigation into the family of UAA transporter proteins still remains largely untouched. Paragraph provided by undergraduates at the Keck Science Department of Claremont McKenna, Pitzer, and Scripps Colleges.

Associated Literature

No Data fetched for Associated Literature

Sequences

>TTHERM_00239130(coding)
ATGAAGATACATGGAAAATTATTAAAATTCTCCATTGGTGTAGGAGGAATTTATGCTTCA
TATATGATCTATGGGCTAGTTCAAGAAAAATTATTTAAGAAGGAATACCCTTCTATTGAT
GGTAAAAGTTAAGATAAATTCAGGCATTCTTTTTTACTCCTCTTTACTCAGTGCTTCTTT
TCTGTAATACTAGCCTTTATTGTTAACAAAGTTAATCAAGCTAAGACTTAGATAAGCTTT
TAAGAGAAATTTATTATGGGATTTTTTAACTTTGTTTCGATGATTGGCAGTAATACAGCT
TTAGGATACATGTCTTACCCTCTCTAAGCTTTGTTTAAGAGCTGTAAAGTTTTGTCAGTT
TTAATTGTAGGATTAATTTTTGGTAAAGTTGATTATCCACTCAATTAATATATCTGCGGT
GTTGTCGTTACCATTGGCATTATTCTATTCAACTTATGTGATGACATGAAATCAGGTAAA
GAGACTTAATTTGTAGGTATTGCTTTAATTTTAACATCATTGTTTTGTGATGGCATGTTA
GCAGAAAAGCAAGCAGAGATGAGAAAAAAGTAAAATCCATCTTCTTTTGAGTTAATGGAA
ATATGCTCTTTCTGGTGTGCTGTTTTGTCTCTTGCATATGGTGCAGTTAGTGGAAGCTTG
ATTACTTGCATTAATTTTATTTTAACTCATAATGATATTTTATTTGATGTATTGACAATT
GGTTTCTTAGGCTGCATTGGATAAGTCTTTATCTTTTTCACAATTCGCCACTTCGGCCCT
GTCATTCTTGCTCTAGTAACTACTACTCGTAAATTCTTTACTGTCCTTGCCAGTATTGCA
TACTTTGGTCACAACCTCTTCTTTGGGTAATGGGTAGGTGTTTCTTTAGTATTACTAGGA
GTTTCATATGAATTATATGAAGGATATAAAAAGAATAGCTAACACAATAAATAAAAAGCA
GAGCAAGCAGCATCTCATAAAGAGTTGCCAGTTAAAGAAAATAATAGCGAAACTCAACCT
TTAAAATAAAATAAGAGCTCTAATTAGCAAAATGGAAAAAATAGTAATGAAGTAGACAAA
AAACATTAAAAATAAAATTGA


>TTHERM_00239130(protein)
MKIHGKLLKFSIGVGGIYASYMIYGLVQEKLFKKEYPSIDGKSQDKFRHSFLLLFTQCFF
SVILAFIVNKVNQAKTQISFQEKFIMGFFNFVSMIGSNTALGYMSYPLQALFKSCKVLSV
LIVGLIFGKVDYPLNQYICGVVVTIGIILFNLCDDMKSGKETQFVGIALILTSLFCDGML
AEKQAEMRKKQNPSSFELMEICSFWCAVLSLAYGAVSGSLITCINFILTHNDILFDVLTI
GFLGCIGQVFIFFTIRHFGPVILALVTTTRKFFTVLASIAYFGHNLFFGQWVGVSLVLLG
VSYELYEGYKKNSQHNKQKAEQAASHKELPVKENNSETQPLKQNKSSNQQNGKNSNEVDK
KHQKQN


>TTHERM_00239130(gene)
ATGAAGATACATGGAAAATTATTAAAATTCTCCATTGGTGTAGGAGGAATTTATGCTTCA
TATATGATCTATGGGCTAGTTCAAGAAAAATTGTAAACTGATTAAAAAATGAAGCAATTT
AGCATTTTTAAATTAAAATATATTATTAGTAGAATAAATAGACATTTAAATCTTTATTTA
AATTATCATAAACAAACAGTAAGTATATGCAAAATATTTTTATTTATAAATAGATTTAAG
AAGGAATACCCTTCTATTGATGGTAAAAGTTAAGATAAATTCAGGCATTCTTTTTTACTC
CTCTTTACTCAGTGCTTCTTTTCTGTAATACTAGCCTTTATTGTTAACAAAGTTAATCAA
GCTAAGACTTAGATAAGCTTTTAAGAGAAATTTATTATGGGATTTTTTAACTTTGTTTCG
ATGATTGGCAGTAATACAGCTTTAGGATACATGTCTTACCCTCTCTAAGCTTTGTTTAAG
AGCTGTAAAGTTTTGTCAGTTTTAATTGTAGGATTAATTTTTGGTAAAGTTGATTATCCA
CTCAATTAATATATCTGCGGTGTTGTCGTTACCATTGGCATTATTCTATTCAACTTATGT
GATGTAATTAATATTTATACTTAATAAGGGTTAATATTTGATGTTTTAACTTAAAGGACA
TGAAATCAGGTAAAGAGACTTAATTTGTAGGTATTGCTTTAATTTTAACATCATTGTTTT
GTGATGGCATGTTAGCAGAAAAGCAAGCAGAGATGAGAAAAAAGTAAAATCCATCTTCTT
TTGAGTTAATGGAAATATGCTCTTTCTGGTGTGCTGTTTTGTCTCTTGCATATGGTGCAG
TTAGTGGAAGCTTGATTACTTGCATTAATTTTATTTTAACTCATAATGATATTTTATTTG
ATGTATTGACAATTGGTTTCTTAGGCTGCATTGGATAAGTCTTTATCTTTTTCACAATTC
GCCACTTCGGCCCTGTCATTCTTGCTCTAGTAACTACTACTCGTAAATTCTTTACTGTCC
TTGCCAGTATTGCATACTTTGGTCACAACCTCTTCTTTGGGTAATGGGTAGGTGTTTCTT
TAGTATTACTAGGAGTTTCATATGAATTATATGAAGGATATAAAAAGAATAGCTAACACA
ATAAATAAAAAGCAGAGCAAGCAGCATCTCATAAAGAGTTGCCAGTTAAAGAAAATAATA
GCGAAACTCAACCTTTAAAATAAAATAAGAGCTCTAATTAGCAAAATGGAAAAAATAGTA
ATGAAGTAGACAAAAAACATTAAAAATAAAATTGA