Identifiers and Description

Gene Model Identifier

TTHERM_01151550

Standard Name

MRT4 (mRNA turnover protein 4)

Aliases

PreTt20194 | 256.m00027 | 3826.m00076

Description

Protein involved in mRNA turnover and ribosome assembly

Genome Browser (Macronucleus)

GBrowse

Genome Browser (Micronucleus)

GBrowse

Gene Ontology Annotations

No Data fetched for Gene Ontology Annotations

Domains

Gene Expression Profile

  • Tetrahymena Functional Genomics Database:

TetraMine Data

TTHERM_01151550

WebApollo

Fullscreen View

Tetrahymena Stock Center

No Data fetched for StockID

Homologs (v.2006 protein sequences)

SourceIdentifierScoreDescription
Tetrahymena borealisEI9_20744.13.0009023271667765e-140hypothetical protein (222 aa)
OxytrichaContig5504.0.g722.999948199478294e-54Ribosomal protein L10
DictyBaseDDB_G02764112.9989272749380808e-50mrt4 on chromosome: 2 position
6846542 to 6847303
WormBaseWBGene000173474.000437458487249e-40status:Confirmed UniProt:Q19
302 protein_id:CCD69167.1
SGDYKL009W2.998577119979921e-31MRT4 Protein involved in mRNA
turnover and ribosome assembly
, localizes to the nucleolus
Stentor CoeruleusSteCoe_354541.1548224173015786e-17

General Information

No Data fetched for General Information

Associated Literature

No Data fetched for Associated Literature

Sequences

>TTHERM_01151550(coding)
ATGCCTAAGTCCAAAAGATCTAAAGTTGTAGCATTAACTAAGGTTAAGAAAGATGCCACA
GGACACAAGCAAAAAATTCAAAATAAATTAAATGAATGTGTCCAAAAGTACGATAACATC
TATGTTTTCTCTCATGAAAATATGACCACTATCCCATTCAGAGAGATTCAAGCTTAATGG
AGTGATTCAAGATTCTTCTTAGGTAAAAACAAAGTCATGCAAATCGTTTTAGGAAAGGAC
TCTGATTCAGAATAATTAGACAACTTACATTACTTGACTGAATAAATTAAGGGTGATTGT
GGTTTGCTTTTCACTAACAAAACCTATGAAGAAGTCAAAAATTTCTTTGATTCATATGGA
TGCGAAGAATTTGCCAAGGCCGGACATGTTGCCAACGAAACTATAATTCTTTAAAAGGAT
AGTGATGTCTTCAATACATTTGCTCACACTATGGATGTTTACTTGAGAAAACTTGGTGTA
GATGTTATCTTATAAAATGGTATTTTGAACTTACAATCTAATTTTGTACTTTGCCAAGAA
GGAAAACCCATAAACACTGAATAAGCTAAGCTTTTGAAATTGTTAGGATACAAGATAGCA
TAGTTTAAGATAGAATTAAAGTGCTGCTATCACAAGCCATCAACCACTTTCAAAAAGTTA
AATTGA


>TTHERM_01151550(protein)
MPKSKRSKVVALTKVKKDATGHKQKIQNKLNECVQKYDNIYVFSHENMTTIPFREIQAQW
SDSRFFLGKNKVMQIVLGKDSDSEQLDNLHYLTEQIKGDCGLLFTNKTYEEVKNFFDSYG
CEEFAKAGHVANETIILQKDSDVFNTFAHTMDVYLRKLGVDVILQNGILNLQSNFVLCQE
GKPINTEQAKLLKLLGYKIAQFKIELKCCYHKPSTTFKKLN


>TTHERM_01151550(gene)
ATGCCTAAGTCCAAAAGATCTAAAGTTGTAGCATTAACTAAGGTTAAGAAAGATGCCACA
GGACACAAGCAAAAAATTCAAAATAAATTAAATGAATGTGTCCAAAAGTACGATAACATC
TATGTTTTCTCTCATGAAAATATGACCACTATCCCATTCAGAGAGATTCAAGCTTAATGG
AGTGATTCAAGGTAATAATTAACTTAAATATGTCAAACTTCATTAGGAGCTTATTTATAT
ATATACAAAAATGAATATATAATCTAATTGTATTTTTTAATTATTAAAGATTCTTCTTAG
GTAAAAACAAAGTCATGCAAATCGTTTTAGGAAAGGACTCTGATTCAGAATAATTAGACA
ACTTACATTACTTGACTGAATAAATTAAGGGTGATTGTGGTTTGCTTTTCACTAACAAAA
CCTATGAAGAAGTCAAAAAGTAACTTACTTTTTTTATATATGAGCTTTCGAGGTATTAAA
TTTAAAATAACCTATTATAATAGTTTCTTTGATTCATATGGATGCGAAGAATTTGCCAAG
GCCGGACATGTTGCCAACGAAACTATAATTCTTTAAAAGGATAGTGATGTCTTCAATACA
TTTGCTCACACTATGGATGTTTACTTGAGAAAACTTGGTGTAGATGTTATCTTATAAAAT
GGTATTTTGAACTTACAATCTAATTTTGTACTTTGCCAAGAAGGAAAACCCATAAACACT
GAATAAGCTAAGCTTTTGGTATATATTTAATTTTAGTTGAATTAAAAATTTGCTTCAAAG
GATAATATTAGTTAGTATCAATCGCTTAATCCAAAATGAGCAATATTGCCAGGACAAGAT
TAATTTATTTTAACGTTTAAATAAATAAATAAATTGATTGAATTTGAAGCAAATATTTTT
AGAAGAATTTCATTAAACTTTTTTTATTTAAAATAAATAGAAATTGTTAGGATACAAGAT
AGCATAGTTTAAGATAGAATTAAAGTGCTGCTATCACAAGCCATCAACCACTTTCAAAAA
GTTAAATTGA