Identifiers and Description

Gene Model Identifier

TTHERM_01151550

Standard Name

MRT4 (mRNA turnover protein 4)

Aliases

PreTt20194 | 256.m00027 | 3826.m00076

Description

MRT4 ribosomal protein L10 family protein; Protein involved in mRNA turnover and ribosome assembly

Genome Browser (Macronucleus)

GBrowse

Genome Browser (Micronucleus)

GBrowse

Gene Ontology Annotations

No Data fetched for Gene Ontology Annotations

Domains

Gene Expression Profile

  • Tetrahymena Functional Genomics Database:

Change in Gene Expression

TMHMM

TMHMM

Signal Peptide

Signal Peptide Present?: No
Presense Probability: 10.2%

TetraMine Data

TTHERM_01151550

WebApollo

Fullscreen View

Tetrahymena Stock Center

No Data fetched for StockID

Homologs (v.2006 protein sequences)

SourceIdentifierScoreDescription
Tetrahymena borealisEI9_20744.13.0009023271667765e-140hypothetical protein (222 aa)
OxytrichaContig5504.0.g722.999948199478294e-54Ribosomal protein L10
DictyBaseDDB_G02764112.9989272749380808e-50mrt4 on chromosome: 2 position
6846542 to 6847303
WormBaseWBGene000173474.000437458487249e-40status:Confirmed UniProt:Q19
302 protein_id:CCD69167.1
SGDYKL009W2.998577119979921e-31MRT4 Protein involved in mRNA
turnover and ribosome assembly
, localizes to the nucleolus
Stentor CoeruleusSteCoe_354541.1548224173015786e-17

General Information

No Data fetched for General Information

Associated Literature

No Data fetched for Associated Literature

Sequences

>TTHERM_01151550(coding)
ATGCCTAAGTCCAAAAGATCTAAAGTTGTAGCATTAACTAAGGTTAAGAAAGATGCCACA
GGACACAAGCAAAAAATTCAAAATAAATTAAATGAATGTGTCCAAAAGTACGATAACATC
TATGTTTTCTCTCATGAAAATATGACCACTATCCCATTCAGAGAGATTCAAGCTTAATGG
AGTGATTCAAGATTCTTCTTAGGTAAAAACAAAGTCATGCAAATCGTTTTAGGAAAGGAC
TCTGATTCAGAATAATTAGACAACTTACATTACTTGACTGAATAAATTAAGGGTGATTGT
GGTTTGCTTTTCACTAACAAAACCTATGAAGAAGTCAAAAATTTCTTTGATTCATATGGA
TGCGAAGAATTTGCCAAGGCCGGACATGTTGCCAACGAAACTATAATTCTTTAAAAGGAT
AGTGATGTCTTCAATACATTTGCTCACACTATGGATGTTTACTTGAGAAAACTTGGTGTA
GATGTTATCTTATAAAATGGTATTTTGAACTTACAATCTAATTTTGTACTTTGCCAAGAA
GGAAAACCCATAAACACTGAATAAGCTAAGCTTTTGAAATTGTTAGGATACAAGATAGCA
TAGTTTAAGATAGAATTAAAGTGCTGCTATCACAAGCCATCAACCACTTTCAAAAAGTTA
AATTGA


>TTHERM_01151550(protein)
MPKSKRSKVVALTKVKKDATGHKQKIQNKLNECVQKYDNIYVFSHENMTTIPFREIQAQW
SDSRFFLGKNKVMQIVLGKDSDSEQLDNLHYLTEQIKGDCGLLFTNKTYEEVKNFFDSYG
CEEFAKAGHVANETIILQKDSDVFNTFAHTMDVYLRKLGVDVILQNGILNLQSNFVLCQE
GKPINTEQAKLLKLLGYKIAQFKIELKCCYHKPSTTFKKLN


>TTHERM_01151550(gene)
ATGCCTAAGTCCAAAAGATCTAAAGTTGTAGCATTAACTAAGGTTAAGAAAGATGCCACA
GGACACAAGCAAAAAATTCAAAATAAATTAAATGAATGTGTCCAAAAGTACGATAACATC
TATGTTTTCTCTCATGAAAATATGACCACTATCCCATTCAGAGAGATTCAAGCTTAATGG
AGTGATTCAAGGTAATAATTAACTTAAATATGTCAAACTTCATTAGGAGCTTATTTATAT
ATATACAAAAATGAATATATAATCTAATTGTATTTTTTAATTATTAAAGATTCTTCTTAG
GTAAAAACAAAGTCATGCAAATCGTTTTAGGAAAGGACTCTGATTCAGAATAATTAGACA
ACTTACATTACTTGACTGAATAAATTAAGGGTGATTGTGGTTTGCTTTTCACTAACAAAA
CCTATGAAGAAGTCAAAAAGTAACTTACTTTTTTTATATATGAGCTTTCGAGGTATTAAA
TTTAAAATAACCTATTATAATAGTTTCTTTGATTCATATGGATGCGAAGAATTTGCCAAG
GCCGGACATGTTGCCAACGAAACTATAATTCTTTAAAAGGATAGTGATGTCTTCAATACA
TTTGCTCACACTATGGATGTTTACTTGAGAAAACTTGGTGTAGATGTTATCTTATAAAAT
GGTATTTTGAACTTACAATCTAATTTTGTACTTTGCCAAGAAGGAAAACCCATAAACACT
GAATAAGCTAAGCTTTTGGTATATATTTAATTTTAGTTGAATTAAAAATTTGCTTCAAAG
GATAATATTAGTTAGTATCAATCGCTTAATCCAAAATGAGCAATATTGCCAGGACAAGAT
TAATTTATTTTAACGTTTAAATAAATAAATAAATTGATTGAATTTGAAGCAAATATTTTT
AGAAGAATTTCATTAAACTTTTTTTATTTAAAATAAATAGAAATTGTTAGGATACAAGAT
AGCATAGTTTAAGATAGAATTAAAGTGCTGCTATCACAAGCCATCAACCACTTTCAAAAA
GTTAAATTGA