Identifiers and Description

Gene Model Identifier

TTHERM_00691810

Standard Name

MRS3 (methionyl-tRNA synthetase 3)

Aliases

PreTt03019 | 106.m00159 | 3674.m00072

Description

methionyl-tRNA synthetase

Genome Browser (Macronucleus)

GBrowse

Genome Browser (Micronucleus)

GBrowse

Gene Ontology Annotations

Cellular Component

Molecular Function

Biological Process

Domains

Gene Expression Profile

  • Tetrahymena Functional Genomics Database:

TetraMine Data

TTHERM_00691810

WebApollo

Fullscreen View

Tetrahymena Stock Center

No Data fetched for StockID

Homologs (v.2006 protein sequences)

SourceIdentifierScoreDescription
Tetrahymena borealisEI9_17560.19.997093137033517e-262methionyl-tRNA synthetase (545
aa)
DictyBaseDDB_G02857591.000434858898539e-105mmetS on chromosome: 4 positio
n 3423740 to 3425574
SGDYGR171C1.9998944264638884e-101MSM1 Mitochondrial methionyl-t
RNA synthetase (MetRS), functi
ons as a monomer in mitochondr
ial protein synthesis; functio
ns similarly to cytoplasmic Me
tRS although the cytoplasmic f
orm contains a zinc-binding do
main not found in Msm1p
WormBaseWBGene000136785.000356947592888e-100status:Partially_confirmed U
niProt:B3KYC0 protein_id:CAQ
76500.1
OxytrichaContig9327.0.0.g581.99970314379378e-94tRNA synthetases class I (M)
Stentor CoeruleusSteCoe_64270.000000000005109089028063325

General Information

No Data fetched for General Information

Associated Literature

No Data fetched for Associated Literature

Sequences

>TTHERM_00691810(coding)
ATGCTAAGTTCCTTAAATAAATTAGTGCATAGATTTTCTAGTTCAAATAAATAAATTTCC
ATTACTACTCCTATCTTTTATGTGAATTCTCAACCTCACATAGGGCATCTATATACTCTC
ATTCTATCTGATGCTTATCATAAATGGAAACTTATAGACAATTATGAATCTTATTTCTAA
ACAGGTACTGATGAACATGGCTAAAAAATACAAAACTCTGCAAAGTAGGCATAAAAAGAT
CCATAATAATTTGTTGATTAAGTCAGTTAAAAATTTGTTGATTTGGCTTCTTAGTATAGC
ATTAGCTATGATAAATTCAATAGAACATCAGATGTATCACACAAAGAGGGAGTTTAACAT
TTTTGGAATGTGCTAGAAAAAAAGGGATTCATTGATATGAAGAAATACGAAGGGTGGTAT
CATACATCAGATGAAACTTTTGTAGGTGAAAAAGATTTAGTCAAAGACTCCTCTGGAAAG
TTTGTAACACAATCTGGATAACCTGTTGATTGGGTTAGTGAGGAAACTCATATTTTTGTA
TTGGATAAAATAAGAGAAGCCGTTATAAAGTATTTAGAAAATGAAAAGCCTGTATACCCT
GAACACTACAATAATAGTATGATTAAATAACTAGAAGAATTGAAGGATATTTCTATTAGT
AGACCTAAATCTAGATTAACATGGGGTATAACAGTACCTTCAAATGAGAAATACACAATT
TATGTTTGGTTGGATGCTTTGACTAACTATTTAACAGGTTTGGGATATCCAAACAATAAT
ATAAATAAAATTCATTTATCCAATAATTTTTTCCATATAATGGGCAAAGATATTTTGAAG
TTTCATTCAATATTTTGGCCAGCATTTTTACTAGCTGCTGGGTACTCAACACCTTAAAAA
ATTTTGATCCATCATCACTGGATCAAAGACAATCAAAAAATGAGCAAAAGCCTTGGAAAT
GTAGTTGATCCAGTTGAATTAGGAAATAAGTATGGTATCGACAGTGTAAGACTTTACTTT
TTGTCAGAAGGTCCACAAGATTTCGATGCAAATTTTGATGAAGTAGATTTGACTAAAACA
TACAATTTATTTATTGAAGGATTCATTAACTTGATGTCAAGAGTTTTCAATAAGAAAATT
ATCAAAGATGGTAAGATTACTGAAATATCTTGGGTGCTTAACGAATAAGATCTCGAATAT
ATCAGCAAATTCACAACTATCAGTAATAAAATTTAAGAACATCTAGACAAGTGTGATTTT
AGAAGAGGTTATTTTGCTATGTCAGAGCTTTGGGGAATGACAAATAAACTTATGACAGAT
CATGCTCCCTGGTAAAAGGATATTTCAGAAGTAGAAAAACAAAAATCTTCATATCTAATA
TTAGAAAGTGTCAGAGTTCTTTCTATCTTCCTTTATCCATTTATACCTTAATATATTTAG
AACGTCTATTAATTAATGAACATTAAAAATGATCGTATAAATACTAATTACTTACAATTT
AGAATTGTAGATAAGAACAATCTACCTAAGTAATCTTTTGGCTTTGAAGAGTTGTCCTCT
GAATTTTTGAAAGTAGATATTGATAATAAGAAGCTTATTTTTAAGCAAAAGTTTGACTTA
CAAAAAAAGATTTGA


>TTHERM_00691810(protein)
MLSSLNKLVHRFSSSNKQISITTPIFYVNSQPHIGHLYTLILSDAYHKWKLIDNYESYFQ
TGTDEHGQKIQNSAKQAQKDPQQFVDQVSQKFVDLASQYSISYDKFNRTSDVSHKEGVQH
FWNVLEKKGFIDMKKYEGWYHTSDETFVGEKDLVKDSSGKFVTQSGQPVDWVSEETHIFV
LDKIREAVIKYLENEKPVYPEHYNNSMIKQLEELKDISISRPKSRLTWGITVPSNEKYTI
YVWLDALTNYLTGLGYPNNNINKIHLSNNFFHIMGKDILKFHSIFWPAFLLAAGYSTPQK
ILIHHHWIKDNQKMSKSLGNVVDPVELGNKYGIDSVRLYFLSEGPQDFDANFDEVDLTKT
YNLFIEGFINLMSRVFNKKIIKDGKITEISWVLNEQDLEYISKFTTISNKIQEHLDKCDF
RRGYFAMSELWGMTNKLMTDHAPWQKDISEVEKQKSSYLILESVRVLSIFLYPFIPQYIQ
NVYQLMNIKNDRINTNYLQFRIVDKNNLPKQSFGFEELSSEFLKVDIDNKKLIFKQKFDL
QKKI


>TTHERM_00691810(gene)
ATGCTAAGTTCCTTAAATAAATTAGTGCATAGAGTAACATAGTTTTAAGCCAAAAAAACA
AAAAATTTACTTTAAATATTTTTATACTTAATTTTTTGAATAGTTTTCTAGTTCAAATAA
ATAAATTTCCATTACTACTCCTATCTTTTATGTGAATTCTCAACCTCACATAGGGCATCT
ATATACTCTCATTCTATCTGATGCTTATCATAAATGGAAACTTATAGACAATTATGAATC
TTATTTCTAAACAGGTAATTTTTATTAGAATTTCAATTTTTAAAATTGTAAACATCGCTT
TTTAATCTACAAAGGTACTGATGAACATGGCTAAAAAATACAAAACTCTGCAAAGTAGGC
ATAAAAAGATCCATAATAATTTGTTGATTAAGTCAGTTAAAAATTTGTTGATTTGGCTTC
TTAGTATAGCATTAGCTATGATAAATTCAATAGAACATCAGATGGTAAGAAAGAATGTTT
TTTTCATAATTTTTTTGAAAATGATTATTGCCATAGCTTCACTGGAAAGTCTTTAAAATA
ATTTGTTTATCATTAATAGTATCACACAAAGAGGGAGTTTAACATTTTTGGAATGTGCTA
GAAAAAAAGGGATTCATTGATATGAGTAATAAATATTTCTCCCAAACGATCAATCAATGT
TTAATAATATTATTTGTTAGAGAAATACGAAGGGTGGTATCATACATCAGATGAAACTTT
TGTAGGTGAAAAAGATTTAGTCAAAGACTCCTCTGGAAAGTTTGTAAATTACTTGTTATT
TATTTATTAGTTTAACTTAGTTCTATTATAAAATTTATTAAATGAAATCTTTGTTAATAG
GTAACACAATCTGGATAACCTGTTGATTGGGTTAGTGAGGAAACTCATATTTTTGTATTG
GATAAAATAAGAGAAGCCGTTATAAAGTATTTAGAAAATGAAAAGCCTGTATACCCTGAA
CACTACAATAATAGTATGATTAAATAACTAGAAGAATTGAAGGTAAATTACTAAATTTAA
TAAATACTTTAAAAAATAATATTTATTATTTTCATGAAAAATTACGCATTATCTAATTTG
TATTAAAAACGCATTATTTTATAATATTAAGGATATTTCTATTAGTAGACCTAAATCTAG
ATTAACATGGGGTATAACAGTACCTTCAAATGAGAAATACACAATTTATGTTTGGTTGGA
TGCTTTGACTAACTATTTAACAGGTTTGGGATATCCAAACAATAATATAAATAAAATTCA
TTTATCCAATAATTTTTTCCATATAATGGGCAAAGATATTTTGAAGTTTCATTCAATATT
TTGGCCAGCATTTTTACTAGCTGCTGGGTACTCAACACCTTAAAAAATTTTGATCCATCA
TCACTGGATCAAAGACAATGTAAAAATAATTTTTAAAACAAAAAACCTCAATAATAATCA
TAAATTAATAAACAGCAAAAAATGAGCAAAAGCCTTGGAAATGTAGTTGATCCAGTTGAA
TTAGGAAATAAGTATGGTATCGACAGTGTAAGACTTTACTTTTTGTCAGAAGGTCCACAA
GATTTCGATGCAAATTTTGATGAAGTAGATTTGACTAAAACATACAATTTATTTATTGAA
GGATTCAGTAATTTAAATTCAATTAAAATAATTAATGCTAAACATAATATTTAATTTCTA
GTTAACTTGATGTCAAGAGTTTTCAATAAGAAAATTATCAAAGATGGTAAGATTACTGAA
ATATCTTGGGTGCTTAACGAATAAGATCTCGAATATATCAGCAAATTCACAACTATCAGT
AATAAAATTTAAGAACATCTAGACAAGTGTGATTTTAGAAGAGGTTATTTTGCTATGTCA
GAGCTTTGGGGAATGACAAATAAACTTATGACAGATCATGCTCCCTGGTAAAAGGATATT
TCAGAAGTAGAAAAACAAAAATCTTCATATCTAATATTAGAAAGTGTCAGAGTTCTTTCT
ATCTTCCTTTATCCATTTATACCTTAATATATTTAGAACGTCTATTAATTAATGAACATT
AAAAATGATCGTATAAATACTAATTACTTACAATTTAGAATTGTAGATAAGAACAATCTA
CCTAAGTAATCTTTTGGCTTTGAAGAGTTGTCCTCTGAATTTTTGAAAGTAGATATTGAT
AATAAGAAGCTTATTTTTAAGCAAAAGTTTGACTTACAAAAAAAGATTTGA