Identifiers and Description

Gene Model Identifier

TTHERM_01145010

Standard Name

MRS1 (methionyl-tRNA synthetase 1)

Aliases

PreTt01416 | 253.m00041

Description

methionyl-tRNA synthetase

Genome Browser (Macronucleus)

GBrowse

Genome Browser (Micronucleus)

GBrowse

Gene Ontology Annotations

Cellular Component

Molecular Function

Biological Process

Domains

Gene Expression Profile

  • Tetrahymena Functional Genomics Database:

TetraMine Data

TTHERM_01145010

WebApollo

Fullscreen View

Tetrahymena Stock Center

No Data fetched for StockID

Homologs (v.2006 protein sequences)

SourceIdentifierScoreDescription
Stentor CoeruleusSteCoe_64270
WormBaseWBGene000034159.997093137033517e-262locus:mars-1 status:Partiall
y_confirmed UniProt:D3YT55
protein_id:CBK19452.1
Tetrahymena borealisEI9_19320.19.997093137033517e-262methionyl-tRNA synthetase (838
aa)
DictyBaseDDB_G02791139.997093137033517e-262metS on chromosome: 3 position
1648404 to 1650743
OxytrichaContig1085.1.g659.997093137033517e-262tRNA synthetases class I (M)
SGDYGR264C9.997093137033517e-262MES1 Methionyl-tRNA synthetase
, forms a complex with glutamy
l-tRNA synthetase (Gus1p) and
Arc1p, which increases the cat
alytic efficiency of both tRNA
synthetases; also has a role
in nuclear export of tRNAs

General Information

No Data fetched for General Information

Associated Literature

No Data fetched for Associated Literature

Sequences

>TTHERM_01145010(coding)
ATGGAAGTTAAACTTAGAAAATTCACAACCAAGGGTTAAGCACTTGTTGCTTCAGCCAAC
CTTTTCCATGAGGAAAAAAAGATTACATTCTCAAGGGATGAATCTGTAGCAAATGACACT
CTTGCTGTCTAAAATTAATAAGCAATTAGCGGATGGACTGCTATTTTCTCTTATCTCCTC
TAGTTAAAGATTGATAGTCCTTTATTTGGTGATTTCTACTTTGTTTGCAACTAATTGAAG
AGTGGTAAAAGATAAGTAGAAGAAAATGCCTTAGAAAATTTGAATAAAATACTTTCTACC
AGATAATTCTTAAGCGGAGAAGAACTTGGTGAAATTGATGTTATTGCTTACACTCGTGTC
AGAGCCTTTGTTAAGGATCTTCCTTTCAGCATTAAGCGTTTTACCCATCTCCACGATTGG
TTTGTTGCTGCTTAATCAACCTTAGAAGATGCTGTTAGCAAAGCTGAAACTTTCGTTGCT
TAACCTGTTGTTAAGGAAAAGAAAGCTGCTGGAAAAAAACCAGAAGGCAAACCTGAAAAA
CCAGAAAAGGCTGAAAAAACTGAAAATCCTAAAAAGGCTGAAAAAACAGAAAAAGCTGAA
AACCCTAAGAAGGCTGAAAAGGCTGAGAAAAAGGAAGCCAAAAAAGAAAAGGCTGAAAAA
CCTGCTGCTACTGAAGCTCCTAAAAAGGCTCCTGCTAAAGTTGATACTATCGATCCTGCT
TATAAGGAAAAAATTAACAATATTAGATTCGTTAGAAGCAATAAGGGTGAACCCGTTTTA
CCAGTAGATGGTTAAAGAAACATTTTGATCACCTCTGCTCTTCCTTACGTCAATAACGCT
CCTCACTTGGGTACATTGATTGGATGTGTCTTGAGTGGTGATGTTTTTGCTAGATATTGC
AGATCTAGAGGTTATAATACAATTTACATTTGTGGTACTGATGAATACGGTACTGCCACT
GAAATGAAGGCTCTTCAAGAAAAGACTACTCCTGCTGAAATTTGTACTAAGTACTATAAG
ATTTAAAAGGATGTCTATGATTGGTTTGATATCGATTTTGATATTTTCGGAAGAACCACT
ACTGAAAAGCACACCAAGATTTCTCAAGATATTTTCTTAACTCTTCATAAGAATGGTTAC
ATCAAGGAAGACATCATGCACCAAAGTTTCTGTGCTGCTTGTGATAAATTCTTAGCAGAC
AGATACGTTAACGGTACTTGCCCCTTCTGCTAACACGATGATTGCCACGGTGATTAATGT
GATAAGTGTGGTAAACTCGTTAATCCTGCCGAACTCATCAATCCTAAATGTACAATTTGC
AAGAATCCTTCTGTTATTAAAGAAACTAAGCACTGCTTCCTCGATTTACCTCAACTTGAA
AAAGAAATCGACGAATTCATTGAAAAGAGATCAAAGGAAGGAGATTGGAGTGATAACGCA
TATAAAACATCCAAGGCTTGGATTAAGAATGGTTTAAAATATAGATGCATTACTAGAGAT
TTAAAATGGGGTACTCCTATTCCTCTTGCTGGTTGGGAAAACAAGGTTATGTACGTATGG
TTCGATGCTCCTATTGGTTATCCTTCCATTACTGCTAATTTGGTTGAAGACTGGGAAAAA
TGGTGGAAAAACCCTGAAAATGTTAAACTTTATCAATTCATCGGTAAGGACAATATTCCT
TTCCACTGTGTCATCTTCCCTGGTACTCTCTTGGGAACTCGTGAAAACTGGACACTACTC
AACTCTATGTCATCTTGTGAATATCTTTAATACGAATCTGGTAAATTCTCTAAGAGTAAA
TGCGTTGGTGTATTTGGTGATGACGCCTAAAAGACTGGCATTCCCGTTGAAGTTTGGAGA
TATTACCTTTTGATTAACAGACCTGAATAAAACGATACTAATTTCTAATGGAGTGACTTT
GCTGCTAAGAATAACAACGAACTTCTTCCTAACGTTGGTAACCTTGTTCAACGTATTTTG
AAATTCCTCTACTCTAAGTTAGAAAAGAAAGTACCTACTTTAGATTTCAGTCTATTGAAC
GAAGAAGATAAGAACTGGTTAGCTTCTATTTGGAATTTGTTCCAACAATATCTTTCTCAT
ATGGAAAAGGTAGAACTCAAGAGTGCTCTTAAGGTTGTTATGTAAATTTCTTCTGAAGGT
AATAATTATATGCAAAAGAATGAACCTTGGAACAAGGCCAACCAAGAAACTGGTAGACAC
ATTGTCTCATTGTTCGTTTTGGTCAACATCATTAGATTCCTCTCTGCCTTATTCGAACCT
TTCATGCCTACTCTCAGTGCTAAAATTAATTTCATGTTGGGTTACGAAGCCAGAACCGCT
AAAGATGAAAAGATCCTTGAATTTATCAGTTCTCAACCTGATGCTATCTCTGGTCTCCTT
TCTCTTGTTCCTGGTGGATAAATCTTAAATGAACCCATTCCTATTTTCAGAAAATTGGAA
GATGATGAAATTGAAAACTTCAAGTTATAATTCAGCGGTGGAAAGAAATTGTGA


>TTHERM_01145010(protein)
MEVKLRKFTTKGQALVASANLFHEEKKITFSRDESVANDTLAVQNQQAISGWTAIFSYLL
QLKIDSPLFGDFYFVCNQLKSGKRQVEENALENLNKILSTRQFLSGEELGEIDVIAYTRV
RAFVKDLPFSIKRFTHLHDWFVAAQSTLEDAVSKAETFVAQPVVKEKKAAGKKPEGKPEK
PEKAEKTENPKKAEKTEKAENPKKAEKAEKKEAKKEKAEKPAATEAPKKAPAKVDTIDPA
YKEKINNIRFVRSNKGEPVLPVDGQRNILITSALPYVNNAPHLGTLIGCVLSGDVFARYC
RSRGYNTIYICGTDEYGTATEMKALQEKTTPAEICTKYYKIQKDVYDWFDIDFDIFGRTT
TEKHTKISQDIFLTLHKNGYIKEDIMHQSFCAACDKFLADRYVNGTCPFCQHDDCHGDQC
DKCGKLVNPAELINPKCTICKNPSVIKETKHCFLDLPQLEKEIDEFIEKRSKEGDWSDNA
YKTSKAWIKNGLKYRCITRDLKWGTPIPLAGWENKVMYVWFDAPIGYPSITANLVEDWEK
WWKNPENVKLYQFIGKDNIPFHCVIFPGTLLGTRENWTLLNSMSSCEYLQYESGKFSKSK
CVGVFGDDAQKTGIPVEVWRYYLLINRPEQNDTNFQWSDFAAKNNNELLPNVGNLVQRIL
KFLYSKLEKKVPTLDFSLLNEEDKNWLASIWNLFQQYLSHMEKVELKSALKVVMQISSEG
NNYMQKNEPWNKANQETGRHIVSLFVLVNIIRFLSALFEPFMPTLSAKINFMLGYEARTA
KDEKILEFISSQPDAISGLLSLVPGGQILNEPIPIFRKLEDDEIENFKLQFSGGKKL


>TTHERM_01145010(gene)
ATGGAAGTTAAACTTAGAAAATTCACAACCAAGGGTTAAGCACTTGTTGCTTCAGCCAAC
CTTTTCCATGAGGAAAAAAAGATTACATTCTCAAGGGATGAATGTAAGAACAAAATATAA
TAATTCGTTTTTCATTCATTTGAAGAATCAAACATTTAATATAATAAACAATAAATAATT
TTTTTTCTATAATTTAATAAAGCTGTAGCAAATGACACTCTTGCTGTCTAAAATTAATAA
GCAATTAGCGGATGGACTGCTATTTTCTCTTATCTCCTCTAGTTAAAGATTGATAGTCCT
TTATTTGGTGATTTCTACTTTGTTTGCAACTAATTGAAGGTATTTATTACTTACTTTCCA
CTAAATAATTAAATATTTTATTCAACTATTTTATATTAAACTTATTAGAGTGGTAAAAGA
TAAGTAGAAGAAAATGCCTTAGAAAATTTGAATAAAATACTTTCTACCAGATAATTCTTA
AGCGGAGTAAATTATTTATCTATTTTTTACTTTTTTCACAAGGAGAAAATATCATTTCTA
AATTAATTAAAAATGAAAATTTCTATCAAATAGCTTAGATTAATATAAAATTATTTTAAT
ATTTTTAGGAAGAACTTGGTGAAATTGATGTTATTGCTTACACTCGTGTCAGAGCCTTTG
TTAAGGATCTTCCTTTCAGCATTAAGCGTTTTACCCATCTCCACGATTGGTTTGTTGCTG
CTTAATCAACCTTAGAAGATGCTGTTAGCAAAGCTGAAACTTTCGTTGCTTAACCTGTTG
TTAAGGAAAAGAAAGCTGCTGGAAAAAAACCAGAAGGCAAACCTGAAAAACCAGAAAAGG
CTGAAAAAACTGAAAATCCTAAAAAGGCTGAAAAAACAGAAAAAGCTGAAAACCCTAAGA
AGGCTGAAAAGGCTGAGAAAAAGGAAGCCAAAAAAGAAAAGGCTGAAAAACCTGCTGCTA
CTGAAGCTCCTAAAAAGGTAAACAATCTTTCTTAAAATATAGAATTAAAATTAGCAAAAT
ATTAAAATACCTTAATTCAACATATAAGTTTAATATATTACTAATAATTAATTTACCAAC
TTACTTAATATATAAATAAAAGGCTCCTGCTAAAGTTGATACTATCGATCCTGCTTATAA
GGAAAAAATTAACAATATTAGATTCGTTAGAAGCAATAAGGGTGAACCCGTTTTACCAGT
AGATGGTTAAAGAAACATTTTGATCACCTCTGCTCTTCCTTACGTCAATAACGCTCCTCA
CTTGGGTACATTGATTGGATGTGTCTTGAGTGGTGATGTTTTTGCTAGATATTGCAGATC
TAGAGGTTATAATACAATTTACATTTGTGGTACTGATGAATACGGTACTGCCACTGAAAT
GAAGGCTCTTCAAGAAAAGACTACTCCTGCTGAAATTTGTACTAAGTACTATAAGATTTA
AAAGGATGTCTATGATTGGTTTGATATCGATTTTGATATTTTCGGAAGAACCACTACTGA
AAAGCACACCAAGATTTCTCAAGATATTTTCTTAACTCTTCATAAGAATGGTTACATCAA
GGAAGACATCATGCACCAAAGTTTCTGTGCTGCTTGTGATAAATTCTTAGCAGACAGATA
CGTTAACGGTACTTGCCCCTTCTGCTAACACGATGATTGCCACGGTGATTAATGTGATAA
GTGTGGTAAACTCGTTAATCCTGCCGAACTCATCAATCCTAAATGTACAATTTGCAAGAA
TCCTTCTGTTATTAAAGAAACTAAGCACTGCTTCCTCGATTTACCTCAACTTGAAAAAGA
AATCGACGAATTCATTGAAAAGTAAACACAACACTAAATTATTTCAACAATATTTTAAAG
TAATTTTTAATAAAATAAATTTTAGGAGATCAAAGGAAGGAGATTGGAGTGATAACGCAT
ATAAAACATCCAAGGCTTGGATTAAGAATGGTTTAAAATATAGATGCATTACTAGAGATT
TAAAATGGGGTACTCCTATTCCTCTTGCTGGTTGGGAAAACAAGGTTATGTACGTATGGT
TCGATGCTCCTATTGGTTATCCTTCCATTACTGCTAATTTGGTTGAAGACTGGGAAAAAT
GGTGGAAAAACCCTGAAAATGTTAAACTTTATCAATTCATCGGTAAGGACAATATTCCTT
TCCACTGTGTCATCTTCCCTGGTACTCTCTTGGGAACTCGTGAAAACTGGACACTACTCA
ACTCTATGTCATCTTGTGAATATCTTTAATACGAATCTGGTAAATTCTCTAAGAGTAAAT
GCGTTGGTGTATTTGGTGATGACGCCTAAAAGACTGGCATTCCCGTTGAAGTTTGGAGAT
ATTACCTTTTGATTAACAGACCTGAATAAAACGATACTAATTTCTAATGGAGTGACTTTG
CTGCTAAGAATAACAACGAACTTCTTCCTAACGTTGGTAACCTTGTTCAACGTATTTTGA
AATTCCTCTACTCTAAGTTAGAAAAGGTAAATTAGTGTTTAAATTTTATTAATTATCATT
CTAAACTTGCATTTTTTATGAACAGAAAGTACCTACTTTAGATTTCAGTCTATTGAACGA
AGAAGATAAGAACTGGTTAGCTTCTATTTGGAATTTGTTCCAACAATATCTTTCTCATAT
GGAAAAGGTAGAACTCAAGAGTGCTCTTAAGGTTGTTATGTAAATTTCTTCTGAAGGTAA
TAATTATATGCAAAAGAATGAACCTTGGAACAAGGCCAACCAAGAAACTGGTAGACACAT
TGTCTCATTGTTCGTTTTGGTCAACATCATTAGATTCCTCTCTGCCTTATTCGAACCTTT
CATGCCTACTCTCAGTGCTAAAATTAATTTCATGTTGGGTTACGAAGCCAGAACCGCTAA
AGATGAAAAGATCCTTGAATTTATCAGTTCTCAACCTGATGCTATCTCTGGTCTCCTTTC
TCTTGTTCCTGGTGGATAAATCTTAAATGAACCCATTCCTATTTTCAGAAAATGTAAATA
AATTTTGTAAAAGTAATAAGAAATTATTAAAAAACATTAATTAAAAAAATAGTGGAAGAT
GATGAAATTGAAAACTTCAAGTTATAATTCAGCGGTGGAAAGAAATTGTGA