Identifiers and Description

Gene Model Identifier

TTHERM_00641130

Standard Name

MRNO54 (Membrane Occupation and Recognition Nexus protein other)

Aliases

PreTt10582 | 92.m00124 | RSK4

Description

Protein with predicted MORN domains localized throughout the protein and/or associated with other domains having a predicted function. Sequence similarity to a protein kinase family unique to Tetrahymena thermophila (Eisen et al., 2006)."

Genome Browser (Macronucleus)

GBrowse

Genome Browser (Micronucleus)

GBrowse

Gene Ontology Annotations

Molecular Function

Biological Process

Domains

  • ( PF02493 ) MORN repeat
  • ( PF07661 ) MORN repeat variant
  • ( PF00069 ) protein kinase domain
  • ( PF07714 ) protein tyrosine kinase
  • ( TIGR00019 ) peptide chain release factor 1
  • ( PF05316 ) Mitochondrial ribosomal protein (VAR1)

Gene Expression Profile

  • Tetrahymena Functional Genomics Database:

TetraMine Data

TTHERM_00641130

WebApollo

Fullscreen View

Tetrahymena Stock Center

No Data fetched for StockID

Homologs (v.2006 protein sequences)

SourceIdentifierScoreDescription
Tetrahymena borealisEI9_10026.19.995193436412938e-154hypothetical protein (754 aa)
OxytrichaContig19525.0.g1136.998985483803218e-56MORN repeat
Stentor CoeruleusSteCoe_213102.031092662734811e-42
DictyBaseDDB_G03494886.998020510507768e-25DDB_G0349488 on chromosome: 2
position 6912714 to 6914186
SGDYLR113W3.998609120989657e-17HOG1 Mitogen-activated protein
kinase involved in osmoregula
tion; acts via three independe
nt osmosensors; mitophagy-spec
ific regulator; mediates the r
ecruitment and activation of R
NA Pol II at Hot1p-dependent p
romoters; localization regulat
ed by Ptp2p and Ptp3p
WormBaseWBGene000022040.00000000000003999587784428659locus:kin-21 status:Partiall
y_confirmed UniProt:G5EBM6
protein_id:CAA94238.2

General Information

No Data fetched for General Information

Associated Literature

No Data fetched for Associated Literature

Sequences

>TTHERM_00641130(coding)
ATGGATATATTTGATCCTTTAAGTGAACAGAGTATCAAATAATTTTTAGAATCTAAGAAA
AGTTAAATTTATAGTAAAACAATTTTGAAGGCAATAGATTTTCTTAAAACTAAATAATAT
TTAGTTTAAAAATTGATTAATTGTGGAGAATTTGGATTAGTTTTTTAAGTATTAGATACC
TCGAATAATAATGTTGTTGCAATAAAACAATTGATAACACAAGACAAAGCTTCTTTAAAC
GAAGTTTAAAAAGAATTTAATAATTTTAAATAATTTAATCACCAAAATGTTAACAAATGC
CACACCTAAATTTACGATGATGTTAATGAATCATTATTTCTAGTATCTGAATTTTGTACA
TTTGGAGATCTATCAACATATCTTCAGTAGTAGGAATTAACAAAAGGAGAAATAATTAAA
ATTATGAAAAACTTAATTTAAGGGATGATTGAAATTCATTCAAAAAATTTAATTCATAGC
GATATTAAACCTTAAAATATTTTGATAGGAAATAATTTAAACCTTTAGATTTGTGGCTTT
GGTCTTTCAAAACTACTAAGCTTGGATAAATCACAAACTTTGGATAACGGGTTAACATAT
TTTTATTCACCTTTAGAGTAAGATGAAGGAAATATTAAATTAGAATCTGATATTTACTCA
TTAGGCTCGATTTTATTATAATTATGTAGAGTAGATTTTTGCAATTACTAAAGTATTTTA
AACTTAAAAAATGGTAACTTCGAGCATATAAAATCTCCTGAATTTGAAGATCTTCTTTAA
ATTGCATTTAAAATGATGCATAAGGACCCCGAGTAGAGACTAAAGCTTATTGATTCAATT
GACTAATTAGATTCTATATCCATAATACTTTAAAATAATATTTAAAATATAGATGGTTAA
TATTAAGGAGAGCTTTAAAATAATATAAGACATGGTCTAGGAACCTAAATATATAATTAA
AGTCATGAACTAAATATTTCATATTATGGCTCTTGGAGAAATGATTAAAAAGAAGGTTTA
GGATGTTAGTCCTTTAAGAATGGAAATAGTTATGTAGGGTGGTGGAAAAGTAATTAAATG
CATGGAAAAGGAATTTTAAGCTATTCTAATGGAAATAGATATGAAGGAGAATTCATAAAT
GATAAGAGAGAAGGTTATGGAATTTTGTATTATTCTAATGGAAATAGATACGAAGGAAAT
TTCAAAAATGGCTTTGCAGATGGTAAAGGAACCCTAATTTGTGCAAACGGAGAGTTACAT
AAAGGATAGTATAAGTATAGTAAAAGAAATGGCTAAGGCATATTATTATATTCTAATGGA
AGCAGATACGAAGGAGAGTTCAAAGACGATAAAATAAATGGAATAGGAATTTTATATTAT
AATGATGGAGCTAAATACGAAGGGGAATTTTAAAATGGATTTGCCCATGGGCAAGGAACT
TTATTAATGGCTAATAAAGATAAATATGTAGGAGAATTTATTAACAACAAAAGAGAAGGC
ATGGGAATATTGTATTATTTTGATGGAAATAGATACGAAGGAGATTTCAAAGATGATAAA
AAAGATGGAAAAGGAATACTATATTATTCTAGTGGAGCTAAATACGAAGGGGAGTTTAAA
AATGGATTTGCTCATGGAAAAGGGACTTTTTTGAAGAGTAATAAAGATAAATATATAGGA
GAATTTATTAAAAACAAAAAAGAAGGTATGGGAATATTGTATTATTATGATGGAAATAGA
TATGAAGGAGATTTCAAAAATAATAAAAGAGATGGAAAAGGAATACTAAATTATTCTGAT
GGAGCAAAATATGAAGGGGAGTTTAAAAATGGAGTTGCTCATGGGAAAGGGACTTTTTTT
CATACCAATAAAGATAGATATGTAGGAGAATTTATTAAGGACAAAAAAGAAGGCATGGGA
ATATTGTATTATTTTGATGGAAAAAAATACGAAGGAGATTTCAAAAATAATAAAAAAGAT
GGAAAAGGAATACTAAATTATTCTGATGGAGCAAAATATGAAGGGGAGTTTAAAAATGGA
GTTGCTCATGGGAAAGGGACTTTTTTTCATACCAATAAAGATAGATATGTAGGAGAATTT
ATTAAGAACAAAAAAGAAGGAATAGGAATATTTTATGATTTTGATGGAAATAGATATGAA
GGAGATTTCAAAGATAATAAAAGAGATGGAAAAGGAATAATATATTATTCTAATGGAGCT
AAATACGAAGGGGAATTTAAAAACGGACTTGTTCATGGAAAAGGGACACTTTTTATGGCT
AATAAAGATAAATATGTAGGAGAATTTATTAACGGCAAAAAAGAAGGCATGGGAATATTT
TATTATTTTGATGGAAATGAATATAAAGGAGAATTCAAAGATAATTAAAGAGATGGAAAA
GGAATACTATATTATTCTAATGGAGCTAAATACGAAGGAGAGTTTAAAAATGGATTTGCT
CATGGAAAAGGGATTTTTTTGATGATTAATAAAGATAAATATGTAGGAGAATTTGTTAAC
AGCAAAAGAGAAGGCCAAGGAATAATTTACTATAATAATGGTAGTCGATTTGAAGGTGAA
TTCAAAAATGATGAAAAAATAAAGGGCTAAATAATAAATAATGATGGCTCAATAAAATTA
TTTTGCAGTTATTGA


>TTHERM_00641130(protein)
MDIFDPLSEQSIKQFLESKKSQIYSKTILKAIDFLKTKQYLVQKLINCGEFGLVFQVLDT
SNNNVVAIKQLITQDKASLNEVQKEFNNFKQFNHQNVNKCHTQIYDDVNESLFLVSEFCT
FGDLSTYLQQQELTKGEIIKIMKNLIQGMIEIHSKNLIHSDIKPQNILIGNNLNLQICGF
GLSKLLSLDKSQTLDNGLTYFYSPLEQDEGNIKLESDIYSLGSILLQLCRVDFCNYQSIL
NLKNGNFEHIKSPEFEDLLQIAFKMMHKDPEQRLKLIDSIDQLDSISIILQNNIQNIDGQ
YQGELQNNIRHGLGTQIYNQSHELNISYYGSWRNDQKEGLGCQSFKNGNSYVGWWKSNQM
HGKGILSYSNGNRYEGEFINDKREGYGILYYSNGNRYEGNFKNGFADGKGTLICANGELH
KGQYKYSKRNGQGILLYSNGSRYEGEFKDDKINGIGILYYNDGAKYEGEFQNGFAHGQGT
LLMANKDKYVGEFINNKREGMGILYYFDGNRYEGDFKDDKKDGKGILYYSSGAKYEGEFK
NGFAHGKGTFLKSNKDKYIGEFIKNKKEGMGILYYYDGNRYEGDFKNNKRDGKGILNYSD
GAKYEGEFKNGVAHGKGTFFHTNKDRYVGEFIKDKKEGMGILYYFDGKKYEGDFKNNKKD
GKGILNYSDGAKYEGEFKNGVAHGKGTFFHTNKDRYVGEFIKNKKEGIGIFYDFDGNRYE
GDFKDNKRDGKGIIYYSNGAKYEGEFKNGLVHGKGTLFMANKDKYVGEFINGKKEGMGIF
YYFDGNEYKGEFKDNQRDGKGILYYSNGAKYEGEFKNGFAHGKGIFLMINKDKYVGEFVN
SKREGQGIIYYNNGSRFEGEFKNDEKIKGQIINNDGSIKLFCSY


>TTHERM_00641130(gene)
ATGGATATATTTGATCCTTTAAGTGAACAGAGTATCAAATAATTTTTAGAATCTAAGAAA
AGTTAAATTTATAGTAAAACAATTTTGAAGGCAATAGATTTTCTTAAAACTAAATAATAT
TTAGTTTAAAAATTGATTAATTGTGGAGAATTTGGATTAGTTTTTTAAGTATTAGATACC
TCGAATAATAATGTTGTTGCAATAAAACAATTGATAACACAAGACAAAGCTTCTTTAAAC
GAAGTTTAAAAAGAATTTAATAATTTTAAATAATTTAATCACCAAAATGTTAACAAATGC
CACACCTAAATTTACGATGATGTTAATGAATCATTATTTCTAGTATCTGAATTTTGTACA
TTTGGAGATCTATCAACATATCTTCAGTAGTAGGAATTAACAAAAGGAGAAATAATTAAA
ATTATGAAAAACTTAATTTAAGGGATGATTGAAATTCATTCAAAAAATTTAATTCATAGC
GATATTAAACCTTAAAATATTTTGATAGGAAATAATTTAAACCTTTAGATTTGTGGCTTT
GGTCTTTCAAAACTACTAAGCTTGGATAAATCACAAACTTTGGATAACGGGTTAACATAT
TTTTATTCACCTTTAGAGTAAGATGAAGGAAATATTAAATTAGAATCTGATATTTACTCA
TTAGGCTCGATTTTATTATAATTATGTAGAGTAGATTTTTGCAATTACTAAAGTATTTTA
AACTTAAAAAATGGTAACTTCGAGCATATAAAATCTCCTGAATTTGAAGATCTTCTTTAA
ATTGCATTTAAAATGATGCATAAGGACCCCGAGTAGAGACTAAAGCTTATTGATTCAATT
GACTAATTAGATTCTATATCCATAATACTTTAAAATAATATTTAAAATATAGATGGTTAA
TATTAAGGAGAGCTTTAAAATAATATAAGACATGGTCTAGGAACCTAAATATATAATTAA
AGTCATGAACTAAATATTTCATATTATGGCTCTTGGAGAAATGATTAAAAAGAAGGTTTA
GGATGTTAGTCCTTTAAGAATGGAAATAGTTATGTAGGGTGGTGGAAAAGTAATTAAATG
CATGGAAAAGGAATTTTAAGCTATTCTAATGGAAATAGATATGAAGGAGAATTCATAAAT
GATAAGAGAGAAGGTTATGGAATTTTGTATTATTCTAATGGAAATAGATACGAAGGAAAT
TTCAAAAATGGCTTTGCAGATGGTAAAGGAACCCTAATTTGTGCAAACGGAGAGTTACAT
AAAGGATAGTATAAGTATAGTAAAAGAAATGGCTAAGGCATATTATTATATTCTAATGGA
AGCAGATACGAAGGAGAGTTCAAAGACGATAAAATAAATGGAATAGGAATTTTATATTAT
AATGATGGAGCTAAATACGAAGGGGAATTTTAAAATGGATTTGCCCATGGGCAAGGAACT
TTATTAATGGCTAATAAAGATAAATATGTAGGAGAATTTATTAACAACAAAAGAGAAGGC
ATGGGAATATTGTATTATTTTGATGGAAATAGATACGAAGGAGATTTCAAAGATGATAAA
AAAGATGGAAAAGGAATACTATATTATTCTAGTGGAGCTAAATACGAAGGGGAGTTTAAA
AATGGATTTGCTCATGGAAAAGGGACTTTTTTGAAGAGTAATAAAGATAAATATATAGGA
GAATTTATTAAAAACAAAAAAGAAGGTATGGGAATATTGTATTATTATGATGGAAATAGA
TATGAAGGAGATTTCAAAAATAATAAAAGAGATGGAAAAGGAATACTAAATTATTCTGAT
GGAGCAAAATATGAAGGGGAGTTTAAAAATGGAGTTGCTCATGGGAAAGGGACTTTTTTT
CATACCAATAAAGATAGATATGTAGGAGAATTTATTAAGGACAAAAAAGAAGGCATGGGA
ATATTGTATTATTTTGATGGAAAAAAATACGAAGGAGATTTCAAAAATAATAAAAAAGAT
GGAAAAGGAATACTAAATTATTCTGATGGAGCAAAATATGAAGGGGAGTTTAAAAATGGA
GTTGCTCATGGGAAAGGGACTTTTTTTCATACCAATAAAGATAGATATGTAGGAGAATTT
ATTAAGAACAAAAAAGAAGGAATAGGAATATTTTATGATTTTGATGGAAATAGATATGAA
GGAGATTTCAAAGATAATAAAAGAGATGGAAAAGGAATAATATATTATTCTAATGGAGCT
AAATACGAAGGGGAATTTAAAAACGGACTTGTTCATGGAAAAGGGACACTTTTTATGGCT
AATAAAGATAAATATGTAGGAGAATTTATTAACGGCAAAAAAGAAGGCATGGGAATATTT
TATTATTTTGATGGAAATGAATATAAAGGAGAATTCAAAGATAATTAAAGAGATGGAAAA
GGAATACTATATTATTCTAATGGAGCTAAATACGAAGGAGAGTTTAAAAATGGATTTGCT
CATGGAAAAGGGATTTTTTTGATGATTAATAAAGATAAATATGTAGGAGAATTTGTTAAC
AGCAAAAGAGAAGGCCAAGGAATAATTTACTATAATAATGGTAGTCGATTTGAAGGTGAA
TTCAAAAATGATGAAAAAATAAAGGGCTAAATAATAAATAATGATGGCTCAATAAAATTA
TTTTGCAGTTATTGA