Identifiers and Description

Gene Model Identifier

TTHERM_00637100

Standard Name

MRNO53 (Membrane Occupation and Recognition Nexus protein other)

Aliases

PreTt19713 | 91.m00128 | RSK1

Description

Protein with predicted MORN domains localized throughout the protein and/or associated with other domains having a predicted function. Protein kinase domain containing protein.

Genome Browser (Macronucleus)

GBrowse

Genome Browser (Micronucleus)

GBrowse

Gene Ontology Annotations

Molecular Function

Biological Process

Domains

Gene Expression Profile

  • Tetrahymena Functional Genomics Database:

TetraMine Data

TTHERM_00637100

WebApollo

Fullscreen View

Tetrahymena Stock Center

No Data fetched for StockID

Homologs (v.2006 protein sequences)

SourceIdentifierScoreDescription
Tetrahymena borealisEI9_10026.19.997093137033517e-262hypothetical protein (754 aa)
OxytrichaContig16869.0.g262.000214949834694e-50MORN repeat
Stentor CoeruleusSteCoe_213103.6251409191435593e-34
WormBaseWBGene000201425.0000961330688895e-23locus:aak-2 5-AMP-activated
protein kinase catalytic subun
it alpha-2 status:Confirmed
UniProt:Q95ZQ4 protein_id:
CCD68834.1
DictyBaseDDB_G02691521.9991095569230066e-20mekA on chromosome: 1 position
4015409 to 4017699
SGDYPL153C4.001630327199692e-20RAD53 Protein kinase, required
for cell-cycle arrest in resp
onse to DNA damage; activated
by trans autophosphorylation w
hen interacting with hyperphos
phorylated Rad9p; also interac
ts with ARS1 and plays a role
in initiation of DNA replicati
on

General Information

No Data fetched for General Information

Associated Literature

  1. Ref:16933976: Eisen JA, Coyne RS, Wu M, Wu D, Thiagarajan M, Wortman JR, Badger JH, Ren Q, Amedeo P, Jones KM, Tallon LJ, Delcher AL, Salzberg SL, Silva JC, Haas BJ, Majoros WH, Farzad M, Carlton JM, Smith RK, Garg J, Pearlman RE, Karrer KM, Sun L, Manning G, Elde NC, Turkewitz AP, Asai DJ, Wilkes DE, Wang Y, Cai H, Collins K, Stewart BA, Lee SR, Wilamowska K, Weinberg Z, Ruzzo WL, Wloga D, Gaertig J, Frankel J, Tsao CC, Gorovsky MA, Keeling PJ, Waller RF, Patron NJ, Cherry JM, Stover NA,

Sequences

>TTHERM_00637100(coding)
ATGTAAAACAAAGAAGTTTAAAAGCTAAGCAAAGAGGAAATCAAAGATTTTTTGCAAAGT
AAATAAAGTTATATAACTTCTAACTAAATTTAGCAATCTATAAACTTTCTATCATAATAT
GGCTACCTTGTAGTTTAATTGATAGATTCTGGAAGTTTCGGTGTTGTTATGAAAGCTATT
GATTCTTCGAATAGCAAAAGATATGTAGCTATAAAGATTATCATTGTAACAAATGCTGAT
ATTTTAAAAGAAAATATTTAAGAATATTAGAAATGCCTTTTAATTAATCATCCCAACGTC
ATCAAAAGTTATTAGCAGCTTTACGATGAAGACAATGAATGCTTTTTTATCATTTCAGAG
TTTTGTTAAAAAGGTAATCTGTTTAACTTTTTTAAACAAAACGATATTAAAAAAGAAGAA
ATCGTTGAAATTTGTACTTAAATTATTGAAGGTGTTTTAGCTATTCATGATAAAAATATT
ATACACAGCGACTTAAAGCCTTAAAATATTCTTATCAATGATGATGATAAAATAAAAATA
TGTGATTTAGGAATGTCTAAATAACTCTTAGGATCTAAATCTCACACTATTTCAAAAGGT
GGAAGTTTGGATTATATGTCCCCAGAATAAATTGAAGGTAAACTTAGTAAATAATCTGAT
ATTTACTCAGTAGGATGTATTATTTGCTTTCTTTGTAATATAAACATATTTGGTTTGAAT
ATGATTAATATAAAGAAAGGGATATTTCCTTCTATTTAAGAAAACCCGTGTAAAGAGTTA
GTTAATTTAGCTTTTCAAATGATGAGCGTAGAACCTAAAAATAGAATTCATCTTCAATTT
TGTTTAGATGAATTGAAATAGTTTGAGAAGAGTAACTCAGACAATCAAAAAGGATAAATT
GTTGTAAAATAGTTTTAAAATGGTGATAGGTACTAAGGTGAAATGAAAGAGGGAAAGATG
AATGGAAAAGGAATTTACTTTTATAGCGAATAAAAGATTATAAAAAAATATGAAGGTGAT
TGGGTTAATGATTAGAAAGAAGGTAATGGTACTTTAGAATACTGGAATGGAGATCAATAT
GAAGGAAATTTTAAAAATGATTAAAGAAGTGGTAAAGGAATACTTTATTTTAGTGAAGTA
AATATCTCAAAGAAATACGAAGGTGAATGGGTAAATGATAAATTTGAAGGTTTTGGAATT
TTAGAATTTAGAGATGGTAACATGTATAAAGGATAGTTCTAAAATGGTAGTTTTAATGGA
GAAGGAATAGAGTATTTGAATGGAGATAAATATGAAGGAAATTTCAAAAATGGTTAAAGA
AGCGGCAAAGGAATACTTTATTATAGTGAAACAAGTATCTTAAAGAAATACAAAGGTGAA
TGGGTAAATGATAAATTTGAAGGTTTTGGAATTTTAGAATTTAGAAACGGTGATATATAT
GAAGGATAGTTCTCAAACTATATTTTTAATGGAAAAGGAATTTATTTTTATAGTGATAAT
GCCTTTAGAAAAAAATATGAAGGTGAATGGGTAAATGATAAATTTGAAGGTTTTGGAATT
TTAGAATTTAGAAATGGTGATAAGTATGAAGGATAGTTCTAAAATGGTAGTTTTAATGGA
AAAGGAAAATAATATTTGAATGGAGATAAATATGAAGGAAATTTCAAAAATGGTTAAAAA
AGTGGTAACGGAATACTTTATTATAGTGAAGCAAATACCTTAAAGAAATACGAAGGTGAA
TGGGCAAATGATAAATTTGAAGGTTTTGGAATTTTAGAATTTAGGAACGGTGACATGTAT
GAAGGGTAGTTCTAAAACTATATTTTTAATGGAAAAGGAATTTATTTTTATAGTGAAAAT
GACATTAGAAAAAAATATGAAGGTTATTGGGTTAATGACAAGAAAGAAGGCCAAGGTACT
TTAGAATACTGGAATGGAGATAAATATAAAGGAAATTTCAAAAATGATTAAAGAAGTGGT
TAAGGAATACTTTATTATAATGAAGCAAATATCTCAAAGAAATACGAAGGTGAATGGGCA
AATGATAAATTTGAAGGTTTTGGAATTTTAGAATTTAGAAATGGTAATAAGTATGAAGGA
TAGTTCTAAAATGGTAGTTTTAATGGAAAAGGAATAGAATATTTGAATGGAGATAAATAT
GAAGGAAATTTCAAAAATGGTTAAAAAATTGGCAAAGGAATACTTTATTACAGTGAAACA
AGTATCTTAAAGAAATACGAAGGTGAATGGGTAAATGATAAATTTGAAGGTTTTGGAATT
TTAGAGTATAGAAAAGGTGATATGTATGAAGGATAATTCTAAAATGGTAGTTTTAATGGA
AAAGGTATTTATTTTTATAGTGAAAATGACATTAGAAAAAAATATGAAGGCTATTGGGTT
AAAGGTAAGAAAGAAGGCAAAGGTACTTTAGAATACTGGAATGGAGATAAATATGAAGGA
AACTTTAAAAATGATGAAATAAGTGGTAAGTGA


>TTHERM_00637100(protein)
MQNKEVQKLSKEEIKDFLQSKQSYITSNQIQQSINFLSQYGYLVVQLIDSGSFGVVMKAI
DSSNSKRYVAIKIIIVTNADILKENIQEYQKCLLINHPNVIKSYQQLYDEDNECFFIISE
FCQKGNLFNFFKQNDIKKEEIVEICTQIIEGVLAIHDKNIIHSDLKPQNILINDDDKIKI
CDLGMSKQLLGSKSHTISKGGSLDYMSPEQIEGKLSKQSDIYSVGCIICFLCNINIFGLN
MINIKKGIFPSIQENPCKELVNLAFQMMSVEPKNRIHLQFCLDELKQFEKSNSDNQKGQI
VVKQFQNGDRYQGEMKEGKMNGKGIYFYSEQKIIKKYEGDWVNDQKEGNGTLEYWNGDQY
EGNFKNDQRSGKGILYFSEVNISKKYEGEWVNDKFEGFGILEFRDGNMYKGQFQNGSFNG
EGIEYLNGDKYEGNFKNGQRSGKGILYYSETSILKKYKGEWVNDKFEGFGILEFRNGDIY
EGQFSNYIFNGKGIYFYSDNAFRKKYEGEWVNDKFEGFGILEFRNGDKYEGQFQNGSFNG
KGKQYLNGDKYEGNFKNGQKSGNGILYYSEANTLKKYEGEWANDKFEGFGILEFRNGDMY
EGQFQNYIFNGKGIYFYSENDIRKKYEGYWVNDKKEGQGTLEYWNGDKYKGNFKNDQRSG
QGILYYNEANISKKYEGEWANDKFEGFGILEFRNGNKYEGQFQNGSFNGKGIEYLNGDKY
EGNFKNGQKIGKGILYYSETSILKKYEGEWVNDKFEGFGILEYRKGDMYEGQFQNGSFNG
KGIYFYSENDIRKKYEGYWVKGKKEGKGTLEYWNGDKYEGNFKNDEISGK


>TTHERM_00637100(gene)
ATGTAAAACAAAGAAGTTTAAAAGCTAAGCAAAGAGGAAATCAAAGATTTTTTGCAAAGT
AAATAAAGTTATATAACTTCTAACTAAATTTAGCAATCTATAAACTTTCTATCATAATAT
GGCTACCTTGTAGTTTAATTGATAGATTCTGGAAGTTTCGGTGTTGTTATGAAAGCTATT
GATTCTTCGAATAGCAAAAGATATGTAGCTATAAAGATTATCATTGTAACAAATGCTGAT
ATTTTAAAAGAAAATATTTAAGAATATTAGAAATGCCTTTTAATTAATCATCCCAACGTC
ATCAAAAGTTATTAGCAGCTTTACGATGAAGACAATGAATGCTTTTTTATCATTTCAGAG
TTTTGTTAAAAAGGTAATCTGTTTAACTTTTTTAAACAAAACGATATTAAAAAAGAAGAA
ATCGTTGAAATTTGTACTTAAATTATTGAAGGTGTTTTAGCTATTCATGATAAAAATATT
ATACACAGCGACTTAAAGCCTTAAAATATTCTTATCAATGATGATGATAAAATAAAAATA
TGTGATTTAGGAATGTCTAAATAACTCTTAGGATCTAAATCTCACACTATTTCAAAAGGT
GGAAGTTTGGATTATATGTCCCCAGAATAAATTGAAGGTAAACTTAGTAAATAATCTGAT
ATTTACTCAGTAGGATGTATTATTTGCTTTCTTTGTAATATAAACATATTTGGTTTGAAT
ATGATTAATATAAAGAAAGGGATATTTCCTTCTATTTAAGAAAACCCGTGTAAAGAGTTA
GTTAATTTAGCTTTTCAAATGATGAGCGTAGAACCTAAAAATAGAATTCATCTTCAATTT
TGTTTAGATGAATTGAAATAGTTTGAGAAGAGTAACTCAGACAATCAAAAAGGATAAATT
GTTGTAAAATAGTTTTAAAATGGTGATAGGTACTAAGGTGAAATGAAAGAGGGAAAGATG
AATGGAAAAGGAATTTACTTTTATAGCGAATAAAAGATTATAAAAAAATATGAAGGTGAT
TGGGTTAATGATTAGAAAGAAGGTAATGGTACTTTAGAATACTGGAATGGAGATCAATAT
GAAGGAAATTTTAAAAATGATTAAAGAAGTGGTAAAGGAATACTTTATTTTAGTGAAGTA
AATATCTCAAAGAAATACGAAGGTGAATGGGTAAATGATAAATTTGAAGGTTTTGGAATT
TTAGAATTTAGAGATGGTAACATGTATAAAGGATAGTTCTAAAATGGTAGTTTTAATGGA
GAAGGAATAGAGTATTTGAATGGAGATAAATATGAAGGAAATTTCAAAAATGGTTAAAGA
AGCGGCAAAGGAATACTTTATTATAGTGAAACAAGTATCTTAAAGAAATACAAAGGTGAA
TGGGTAAATGATAAATTTGAAGGTTTTGGAATTTTAGAATTTAGAAACGGTGATATATAT
GAAGGATAGTTCTCAAACTATATTTTTAATGGAAAAGGAATTTATTTTTATAGTGATAAT
GCCTTTAGAAAAAAATATGAAGGTGAATGGGTAAATGATAAATTTGAAGGTTTTGGAATT
TTAGAATTTAGAAATGGTGATAAGTATGAAGGATAGTTCTAAAATGGTAGTTTTAATGGA
AAAGGAAAATAATATTTGAATGGAGATAAATATGAAGGAAATTTCAAAAATGGTTAAAAA
AGTGGTAACGGAATACTTTATTATAGTGAAGCAAATACCTTAAAGAAATACGAAGGTGAA
TGGGCAAATGATAAATTTGAAGGTTTTGGAATTTTAGAATTTAGGAACGGTGACATGTAT
GAAGGGTAGTTCTAAAACTATATTTTTAATGGAAAAGGAATTTATTTTTATAGTGAAAAT
GACATTAGAAAAAAATATGAAGGTTATTGGGTTAATGACAAGAAAGAAGGCCAAGGTACT
TTAGAATACTGGAATGGAGATAAATATAAAGGAAATTTCAAAAATGATTAAAGAAGTGGT
TAAGGAATACTTTATTATAATGAAGCAAATATCTCAAAGAAATACGAAGGTGAATGGGCA
AATGATAAATTTGAAGGTTTTGGAATTTTAGAATTTAGAAATGGTAATAAGTATGAAGGA
TAGTTCTAAAATGGTAGTTTTAATGGAAAAGGAATAGAATATTTGAATGGAGATAAATAT
GAAGGAAATTTCAAAAATGGTTAAAAAATTGGCAAAGGAATACTTTATTACAGTGAAACA
AGTATCTTAAAGAAATACGAAGGTGAATGGGTAAATGATAAATTTGAAGGTTTTGGAATT
TTAGAGTATAGAAAAGGTGATATGTATGAAGGATAATTCTAAAATGGTAGTTTTAATGGA
AAAGGTATTTATTTTTATAGTGAAAATGACATTAGAAAAAAATATGAAGGCTATTGGGTT
AAAGGTAAGAAAGAAGGCAAAGGTACTTTAGAATACTGGAATGGAGATAAATATGAAGGA
AACTTTAAAAATGATGAAATAAGTGGTAAGTGA