Identifiers and Description

Gene Model Identifier

TTHERM_00637120

Standard Name

MRNO50 (Membrane Occupation and Recognition Nexus protein other)

Aliases

PreTt19715 | 91.m00130

Description

Protein with predicted MORN domains localized throughout the protein and/or associated with other domains having a predicted function. Phosphatidylinositol-4-phosphate 5-kinase.

Genome Browser (Macronucleus)

GBrowse

Genome Browser (Micronucleus)

GBrowse

Gene Ontology Annotations

No Data fetched for Gene Ontology Annotations

Domains

Gene Expression Profile

  • Tetrahymena Functional Genomics Database:

Change in Gene Expression

TMHMM

TMHMM

Signal Peptide

Signal Peptide Present?: No
Presense Probability: 10.2%

TetraMine Data

TTHERM_00637120

WebApollo

Fullscreen View

Tetrahymena Stock Center

No Data fetched for StockID

Homologs (v.2006 protein sequences)

SourceIdentifierScoreDescription
Tetrahymena borealisEI9_10026.15.0018479768654576e-80hypothetical protein (754 aa)
OxytrichaContig20548.0.g827.999697430377842e-40MORN repeat
Stentor CoeruleusSteCoe_213101.7587922024243116e-25
WormBaseWBGene000021790.000000000040005666873964816locus:jph-1 status:Confirmed
UniProt:Q22667 protein_id
:CAA99924.2
DictyBaseDDB_G03494880.0000000000599805963605737DDB_G0349488 on chromosome: 2
position 6912714 to 6914186

General Information

No Data fetched for General Information

Associated Literature

No Data fetched for Associated Literature

Sequences

>TTHERM_00637120(coding)
ATGGAGTATAAAAATGGGAATATGTATGAAGGTAATTTCAAAAGTGGCTCAAGATATGGC
AAAGGAGTAATATATTACAGTGAAACATATGATTCAAAGAAGTATGAAGGTGAATGGGTA
AATGATTAGTTTGAAGGTTTTGGAATTTTTGAATGGAGGAGCGGCTCGAGGTATGAAGGG
TAATTTAAAAATGGTGATTTTAATGGAAAAGGAATTTACTATTATAGAGATTAAGATTCA
GAAAAAAAGTATGAAGGAGAGTGGGTCTCGGATAAATAAGAAGGTTTTGGGATTATGGAA
TATAAAAATGGAAATAGGTATGAAGGTAATTTCAAAAATGGCTCAAGAAATGGCTAAGGA
GTATTATATTACAGTAAAACAAATAATTCAAAGAAATACGAAGGTGGATGGTTAAATGAT
TAGTTTGAAGGCTTTGGAATTTTGGAATGGAGGAGTGGCTAGAGGTATGAAGGGTATTTT
AAAAATGGTGATTTTAATGGAAAAGGAATTTACTATTATAGTGATTAAGATTAAGAAAAA
AAGTATGAAGGAGAGTGGGTCTCTGATAAATAAGAAGGTTTTGGAATTATGGAATATAAA
AATGGGAGTAGATATGAAGGTAATTTCAAATATGGCTCAAGAAATGGCAAAGGAGTAATA
TATTACAGTGAAAGATATGATTCAAAGAAATATGAAGGTGAATGGGTAAATGATTAGTTT
GAAGGTTTTGGAATTTTTGAATGGAAGAATGGCTCAATGTATGAAGGGTAGTTTAAAAAT
AATCATTTTAATGGAAAGGGAATCTTCTACTACTATAATGAAGATGATACTAGAAAGAGA
TATGAAGGATAATGGGTTAATGATAAATAGGAAGGCTATGGAATTTTAGAGTATAAAAAT
GGTACTAAATATGAAGGAAACTTCAAGAATGGGAAAAAGAATGGAAAAGGAATCTAATTA
GATTAAAATGGTTAAAAACTTAATGGTGAGTGGATTGATGATAAATTTTAAAATAATTAA
ATATATTATAAAATAAGTAAATATTAATAGTTTTGA


>TTHERM_00637120(protein)
MEYKNGNMYEGNFKSGSRYGKGVIYYSETYDSKKYEGEWVNDQFEGFGIFEWRSGSRYEG
QFKNGDFNGKGIYYYRDQDSEKKYEGEWVSDKQEGFGIMEYKNGNRYEGNFKNGSRNGQG
VLYYSKTNNSKKYEGGWLNDQFEGFGILEWRSGQRYEGYFKNGDFNGKGIYYYSDQDQEK
KYEGEWVSDKQEGFGIMEYKNGSRYEGNFKYGSRNGKGVIYYSERYDSKKYEGEWVNDQF
EGFGIFEWKNGSMYEGQFKNNHFNGKGIFYYYNEDDTRKRYEGQWVNDKQEGYGILEYKN
GTKYEGNFKNGKKNGKGIQLDQNGQKLNGEWIDDKFQNNQIYYKISKYQQF


>TTHERM_00637120(gene)
ATGGAGTATAAAAATGGGAATATGTATGAAGGTAATTTCAAAAGTGGCTCAAGATATGGC
AAAGGAGTAATATATTACAGTGAAACATATGATTCAAAGAAGTATGAAGGTGAATGGGTA
AATGATTAGTTTGAAGGTTTTGGAATTTTTGAATGGAGGAGCGGCTCGAGGTATGAAGGG
TAATTTAAAAATGGTGATTTTAATGGAAAAGGAATTTACTATTATAGAGATTAAGATTCA
GAAAAAAAGTATGAAGGAGAGTGGGTCTCGGATAAATAAGAAGGTTTTGGGATTATGGAA
TATAAAAATGGAAATAGGTATGAAGGTAATTTCAAAAATGGCTCAAGAAATGGCTAAGGA
GTATTATATTACAGTAAAACAAATAATTCAAAGAAATACGAAGGTGGATGGTTAAATGAT
TAGTTTGAAGGCTTTGGAATTTTGGAATGGAGGAGTGGCTAGAGGTATGAAGGGTATTTT
AAAAATGGTGATTTTAATGGAAAAGGAATTTACTATTATAGTGATTAAGATTAAGAAAAA
AAGTATGAAGGAGAGTGGGTCTCTGATAAATAAGAAGGTTTTGGAATTATGGAATATAAA
AATGGGAGTAGATATGAAGGTAATTTCAAATATGGCTCAAGAAATGGCAAAGGAGTAATA
TATTACAGTGAAAGATATGATTCAAAGAAATATGAAGGTGAATGGGTAAATGATTAGTTT
GAAGGTTTTGGAATTTTTGAATGGAAGAATGGCTCAATGTATGAAGGGTAGTTTAAAAAT
AATCATTTTAATGGAAAGGGAATCTTCTACTACTATAATGAAGATGATACTAGAAAGAGA
TATGAAGGATAATGGGTTAATGATAAATAGGAAGGCTATGGAATTTTAGAGTATAAAAAT
GGTACTAAATATGAAGGAAACTTCAAGAATGGGAAAAAGAATGGAAAAGGAATCTAATTA
GATTAAAATGGTTAAAAACTTAATGGTGAGTGGATTGATGATAAATTTTAAAATAATTAA
ATATATTATAAAATAAGTAAATATTAATAGTTTTGA