Identifiers and Description

Gene Model Identifier

TTHERM_00355710

Standard Name

MRNO49 (Membrane Occupation and Recognition Nexus protein other)

Aliases

PreTt27557 | 37.m00274 | 3836.m02363

Description

Protein with predicted MORN domains localized throughout the protein and/or associated with other domains having a predicted function

Genome Browser (Macronucleus)

GBrowse

Genome Browser (Micronucleus)

GBrowse

Gene Ontology Annotations

No Data fetched for Gene Ontology Annotations

Domains

Gene Expression Profile

  • Tetrahymena Functional Genomics Database:

TetraMine Data

TTHERM_00355710

WebApollo

Fullscreen View

Tetrahymena Stock Center

No Data fetched for StockID

Homologs (v.2006 protein sequences)

SourceIdentifierScoreDescription
Tetrahymena borealisEI9_02262.19.997093137033517e-262hypothetical protein (591 aa)
OxytrichaContig3993.0.g1065.0019039340728934e-39MORN repeat
Stentor CoeruleusSteCoe_197443.873997628687187e-21
DictyBaseDDB_G03494882.9992476920535046e-16DDB_G0349488 on chromosome: 2
position 6912714 to 6914186
WormBaseWBGene000021790.0000000000010000211161514907locus:jph-1 status:Confirmed
UniProt:Q22667 protein_id
:CAA99924.2
SGDYGL179C0.0004000184047659232TOS3 Protein kinase, related t
o and functionally redundant w
ith Elm1p and Sak1p for the ph
osphorylation and activation o
f Snf1p; functionally ortholog
ous to LKB1, a mammalian kinas
e associated with Peutz-Jegher
s cancer-susceptibility syndro
me

General Information

No Data fetched for General Information

Associated Literature

No Data fetched for Associated Literature

Sequences

>TTHERM_00355710(coding)
ATGGAAAAGATTGAATTAGATTTACAAACAATTAAAAACTTTCTTGTTCCTTTTAAGCAT
AAAATATCTGCTCAGAATATTTATGAAACTCAAGATTTTTTAAAACAAAGAGGTTATACT
ATTAAAACTATAGAGAGAGCTTCAGATTCTGGTGCTTTAATGATTGCTTACGACTTCAGA
AGAGAATAAGATGTATTTATAAAGTTTATCAAGCATTACGACAAAGATGATTTCAATGAA
GCGATGCTCTATGATGTGCAAACAATTACAATAAAATCTTAATATTTACTCTAAAATAGA
GATTTAATTTGTGATTTAAAAAATAATTGTTACTTTTTAATTATTGAATATTCACCTTTG
AAAAATTTAAGCTAATTTATAAAAGAAAATACTCTTACCTTTCAATAAACACTACAAATT
GTTGTAAATTTGCTATTTGGTTTGAATGATATTCACAATTCTAGCTAAGTTTTAATGTAA
CTAAATCCTTCTAACATATTAGTTTCTCAAGATCTAAGTATTAAAATTCTTAATTTAGGC
TCTCCTTTTAATACCTTGTAAATGATACAAAAAAATAATCCTTTTTTACCTAAAGAGTAA
AACTTTCTAACACTTGTTACTTCTTAGAGCAATTATTATTCTCTTGGAGCTATCATTTGT
CTTCTCTGTAAATTAGATGTCCAGGAAAATTTCATTTTGAGTAAAAATTGCAAAAAAGGA
TTTTTCCCTGTGCTAACTTATGAAAATGAATATAAACAAGTACTAGAAGTAGCATTTTAA
ATGATGAATTTTAATCCTATGTTTAGAATAAATTTTGTTCAAGCACTTCAAAAATTGTAG
AATTTATTTTCTCCATAATTAAACTAAAAAGTTTTGAAATATTTAGAGTTAAATTAAGTA
ATTAATTACAAACAAAAGCTTAATTAAAGGACTGATCTTGAGATTTAGAGTAATGGATGT
ATTTACATAGGTGATTTTGATGGTAATAGAAGACATGGATAAGGAATATTTATAAATTTA
TTAGGAGAAAGATATGAGGGTGGATTTTCTAATGATAAATTTCATGGATAAGGAAGCTAC
TATGATAAAGATGGAAATGTTTATATAGGAGAGTGGTTTGAAGGATAGATGTAAGGAAAA
GGAATCCTATACTATAATAATACTGATTTATACGATGGAAATTTCTTTGCTGGAAAACGA
AATGGCTTTGGTACCTTATATTTTAACAAAGAAGAGAAATATGAAGGTGAATGGGTCTAA
GACTAGAAAGAAGGATATGGAAAATTAAAATTACTTAACAATTAAAAATATGAAGGACAA
TTTAAGCAAGGTACCTTTAATGGTAAAGGTAAGTTTATATACCAAGATGGAAGCTCTTAT
GAAGGAGAATGGCTTAATAATTAAAGACATGGATATGGTGAGTATAAATTTTAAAACGGA
GATAGATACCTCGGTAATTATTGGTATGATAAAAAACAAGGTAATGGAACTTATTACTAT
CATACTGGAAGCTCATACAAAGGTGAATGGAAGAATGATTTAAAAACTGGTCATGGTTTA
TACACAGCATCTAATAATGAAACATACGAAGGAAGTTTTAAAAATGGCAAGAGACATGGA
TATGGAATATACAAATACAATAATGGTCTAACATACCAAGGAGAATGGGAAAATGATTAA
AAGAATGGACTAGGAATACTTCTTGAAAATAATGATATCGTTTTCCAAGGAAAGTGGATG
AATGGACAAAAGCAATAATATTTAAACAAAGAAGAAAGTTGA


>TTHERM_00355710(protein)
MEKIELDLQTIKNFLVPFKHKISAQNIYETQDFLKQRGYTIKTIERASDSGALMIAYDFR
REQDVFIKFIKHYDKDDFNEAMLYDVQTITIKSQYLLQNRDLICDLKNNCYFLIIEYSPL
KNLSQFIKENTLTFQQTLQIVVNLLFGLNDIHNSSQVLMQLNPSNILVSQDLSIKILNLG
SPFNTLQMIQKNNPFLPKEQNFLTLVTSQSNYYSLGAIICLLCKLDVQENFILSKNCKKG
FFPVLTYENEYKQVLEVAFQMMNFNPMFRINFVQALQKLQNLFSPQLNQKVLKYLELNQV
INYKQKLNQRTDLEIQSNGCIYIGDFDGNRRHGQGIFINLLGERYEGGFSNDKFHGQGSY
YDKDGNVYIGEWFEGQMQGKGILYYNNTDLYDGNFFAGKRNGFGTLYFNKEEKYEGEWVQ
DQKEGYGKLKLLNNQKYEGQFKQGTFNGKGKFIYQDGSSYEGEWLNNQRHGYGEYKFQNG
DRYLGNYWYDKKQGNGTYYYHTGSSYKGEWKNDLKTGHGLYTASNNETYEGSFKNGKRHG
YGIYKYNNGLTYQGEWENDQKNGLGILLENNDIVFQGKWMNGQKQQYLNKEES


>TTHERM_00355710(gene)
ATGGAAAAGATTGAATTAGATTTACAAACAATTAAAAACTTTCTTGTTCCTTTTAAGCAT
AAAATATCTGCTCAGAATATTTATGAAACTCAAGATTTTTTAAAACAAAGAGGTTATACT
ATTAAAACTATAGAGAGAGCTTCAGATTCTGGTGCTTTAATGATTGCTTACGACTTCAGA
AGAGAATAAGATGTATTTATAAAGTTTATCAAGCATTACGACAAAGATGATTTCAATGAA
GCGATGCTCTATGATGTGCAAACAATTACAATAAAATCTTAATATTTACTCTAAAATAGA
GATTTAATTTGTGATTTAAAAAATAATTGTTACTTTTTAATTATTGAATATTCACCTTTG
AAAAATTTAAGCTAATTTATAAAAGAAAATACTCTTACCTTTCAATAAACACTACAAATT
GTTGTAAATTTGCTATTTGGTTTGAATGATATTCACAATTCTAGCTAAGTTTTAATGTAA
CTAAATCCTTCTAACATATTAGTTTCTCAAGATCTAAGTATTAAAATTCTTAATTTAGGC
TCTCCTTTTAATACCTTGTAAATGATACAAAAAAATAATCCTTTTTTACCTAAAGAGTAA
AACTTTCTAACACTTGTTACTTCTTAGAGCAATTATTATTCTCTTGGAGCTATCATTTGT
CTTCTCTGTAAATTAGATGTCCAGGAAAATTTCATTTTGAGTAAAAATTGCAAAAAAGGA
TTTTTCCCTGTGCTAACTTATGAAAATGAATATAAACAAGTACTAGAAGTAGCATTTTAA
ATGATGAATTTTAATCCTATGTTTAGAATAAATTTTGTTCAAGCACTTCAAAAATTGTAG
AATTTATTTTCTCCATAATTAAACTAAAAAGTTTTGAAATATTTAGAGTTAAATTAAGTA
ATTAATTACAAACAAAAGCTTAATTAAAGGACTGATCTTGAGATTTAGAGTAATGGATGT
ATTTACATAGGTGATTTTGATGGTAATAGAAGACATGGATAAGGAATATTTATAAATTTA
TTAGGAGAAAGATATGAGGGTGGATTTTCTAATGATAAATTTCATGGATAAGGAAGCTAC
TATGATAAAGATGGAAATGTTTATATAGGAGAGTGGTTTGAAGGATAGATGTAAGGAAAA
GGAATCCTATACTATAATAATACTGATTTATACGATGGAAATTTCTTTGCTGGAAAACGA
AATGGCTTTGGTACCTTATATTTTAACAAAGAAGAGAAATATGAAGGTGAATGGGTCTAA
GACTAGAAAGAAGGATATGGAAAATTAAAATTACTTAACAATTAAAAATATGAAGGACAA
TTTAAGCAAGGTACCTTTAATGGTAAAGGTAAGTTTATATACCAAGATGGAAGCTCTTAT
GAAGGAGAATGGCTTAATAATTAAAGACATGGATATGGTGAGTATAAATTTTAAAACGGA
GATAGATACCTCGGTAATTATTGGTATGATAAAAAACAAGGTAATGGAACTTATTACTAT
CATACTGGAAGCTCATACAAAGGTGAATGGAAGAATGATTTAAAAACTGGTCATGGTTTA
TACACAGCATCTAATAATGAAACATACGAAGGAAGTTTTAAAAATGGCAAGAGACATGGA
TATGGAATATACAAATACAATAATGGTCTAACATACCAAGGAGAATGGGAAAATGATTAA
AAGAATGGACTAGGAATACTTCTTGAAAATAATGATATCGTTTTCCAAGGAAAGTGGATG
AATGGACAAAAGCAATAATATTTAAACAAAGAAGAAAGTTGA