Identifiers and Description

Gene Model Identifier

TTHERM_00637110

Standard Name

MRNO41 (Membrane Occupation and Recognition Nexus protein other)

Aliases

PreTt19714 | 91.m00129

Description

Protein with predicted MORN domains localized throughout the protein and/or associated with other domains having a predicted function. Protein kinase domain containing protein.

Genome Browser (Macronucleus)

GBrowse

Genome Browser (Micronucleus)

GBrowse

Gene Ontology Annotations

Molecular Function

Biological Process

Domains

Gene Expression Profile

  • Tetrahymena Functional Genomics Database:

TetraMine Data

TTHERM_00637110

WebApollo

Fullscreen View

Tetrahymena Stock Center

No Data fetched for StockID

Homologs (v.2006 protein sequences)

SourceIdentifierScoreDescription
Tetrahymena borealisEI9_18802.11.000008670162283e-147hypothetical protein (1043 aa)
OxytrichaContig728.0.g233.998097515166115e-39MORN repeat
WormBaseWBGene000201424.998021988471165e-24locus:aak-2 5-AMP-activated
protein kinase catalytic subun
it alpha-2 status:Confirmed
UniProt:Q95ZQ4 protein_id:
CCD68834.1
DictyBaseDDB_G02708149.998720540547892e-23nek2 on chromosome: 1 position
4847143 to 4848761
SGDYDR507C3.999970367130025e-21GIN4 Protein kinase involved i
n bud growth and assembly of t
he septin ring, proposed to ha
ve kinase-dependent and kinase
-independent activities; under
goes autophosphorylation; simi
lar to Kcc4p and Hsl1p
Stentor CoeruleusSteCoe_213108.533047625744066e-17

General Information

No Data fetched for General Information

Associated Literature

  1. Ref:16933976: Eisen JA, Coyne RS, Wu M, Wu D, Thiagarajan M, Wortman JR, Badger JH, Ren Q, Amedeo P, Jones KM, Tallon LJ, Delcher AL, Salzberg SL, Silva JC, Haas BJ, Majoros WH, Farzad M, Carlton JM, Smith RK, Garg J, Pearlman RE, Karrer KM, Sun L, Manning G, Elde NC, Turkewitz AP, Asai DJ, Wilkes DE, Wang Y, Cai H, Collins K, Stewart BA, Lee SR, Wilamowska K, Weinberg Z, Ruzzo WL, Wloga D, Gaertig J, Frankel J, Tsao CC, Gorovsky MA, Keeling PJ, Waller RF, Patron NJ, Cherry JM, Stover NA,

Sequences

>TTHERM_00637110(coding)
ATGTAAAACAAAGAAGTTTAGAAGCTAAGCAAAGAGGAAATCAAAGATTTTTTGCAAAGT
AAATAAAGTTAAATAACTTCTAACTAAATTTAGCAATCTATAAACTTTCTATCATAATAT
GGCTACCATGTAGTTTAATTGATAGATTCTGGAAGTTTTGGTATTGTTATGAAAGCTATT
GATTCTTCGAATAGCAAAAGATATGTAGCAATAAAGCTTATCATAGTAACAAATACTGAA
ATTTTAAAAGAAAACATTTAAGAATATTAGAAATGCCTTTTAATTAATCATCCCAACGTC
ATCAAAAATTATTAGTAGCTTTATGATGAAGAGAATGAATGCTTTTTTATCATTACAGAG
TTTTGTTAAAAAGGTAATCTGTTTAACTTTTTTAAACAAAACAATATTAAAAAAGAAGAA
ATTGTTGAAATTTGTGCTTAAATTATTGAAGGTGTTTTAGCTATTCATGATAAAAATATT
ATACACAGCGACTTAAAGCCTTAAAATATTCTTATCAATGATGATGATAAAATAAAAATA
TGTGATTTAGGAATGTCTAAATAACTTTTAGGATCAAAATCTCACACCATTTCCAAAGGT
GGAAGTTTGGATTATATGTCACCAGAATAAATTGAAGGTAAGATTAGTAAATAATCTGAC
ATATATTCAGTTGGATGTATTATTTGCTTTCTTTGTAATGTTAACATATTTGGTTTGAAT
ATGGTTAATATAAAGAAAGGGATATTTCCTCCTATATAGGAAAATTGCTTTAAAGAGTTA
GTTAATTTAGCTTTTAAAATGATGAGTGTAGAGCCTAAAAATAGAATTTAGCTTCAAGAT
TCTTTAGATTAGTTGAAATAGTTTTAGAAGATTAACTCACACAATCAAAAAGGAGAAATT
GTTGTAAAATAGTTTTAAAATGGTGATAGATACGAAGGTGAAGTGAAAGATGGAAAGATG
AATGGAAAAGGGATCTACTACTATAAAGAAGATAATATAAGAAAGAAGTATGAAGGATAG
TGGGTTAATGATAAAAAGGATGGCTTTGGTATTTTGGAATATAAAAGTGGGAATAAGTAT
GAAGGATACTTCAAAAACGATTGTTTTAATGGAAAGGGAATTTACTACTATTATAAAGAA
GGTGATAATAAAATGAAGTATGAAGGATAGTGGGTTAATAATCAAAAAGATGGCTTTGGT
ATTTTGGAATATAAAAGTGGGAATAAGTATGAAGGATAATTCAAAAATGATGATTTTAAT
GGAAAGGGAATCTACTACTATAAACAAGGCGACAATATAAAGAAGTATGAAGGATAGTGG
GCTAGTAATTAAAAAGATGGCTTTGGAATTATGGAATATAAAAATGGGAATAGGTATGAA
GGGTAGTTTAAAAATGGTGAATTTAATGGAAAGGGAATCTTCTACTATAAAGAAGATGAT
ATTAAAAAGAGCTATGATGGATTATGGGTTAATGATAAATAGGAAGGCTTTGGAATTTTA
GAGTATAAAAATGGTACTAAATATGAAGGAAACTTCAAGAATGGGAAAAAGAATGGAAAA
GGAATCTAATTAGATTAAAATGGTTAAAAACTTAATGGTGAGTGGATTGATGATAAATTT
TAAACTAATTGA


>TTHERM_00637110(protein)
MQNKEVQKLSKEEIKDFLQSKQSQITSNQIQQSINFLSQYGYHVVQLIDSGSFGIVMKAI
DSSNSKRYVAIKLIIVTNTEILKENIQEYQKCLLINHPNVIKNYQQLYDEENECFFIITE
FCQKGNLFNFFKQNNIKKEEIVEICAQIIEGVLAIHDKNIIHSDLKPQNILINDDDKIKI
CDLGMSKQLLGSKSHTISKGGSLDYMSPEQIEGKISKQSDIYSVGCIICFLCNVNIFGLN
MVNIKKGIFPPIQENCFKELVNLAFKMMSVEPKNRIQLQDSLDQLKQFQKINSHNQKGEI
VVKQFQNGDRYEGEVKDGKMNGKGIYYYKEDNIRKKYEGQWVNDKKDGFGILEYKSGNKY
EGYFKNDCFNGKGIYYYYKEGDNKMKYEGQWVNNQKDGFGILEYKSGNKYEGQFKNDDFN
GKGIYYYKQGDNIKKYEGQWASNQKDGFGIMEYKNGNRYEGQFKNGEFNGKGIFYYKEDD
IKKSYDGLWVNDKQEGFGILEYKNGTKYEGNFKNGKKNGKGIQLDQNGQKLNGEWIDDKF
QTN


>TTHERM_00637110(gene)
ATGTAAAACAAAGAAGTTTAGAAGCTAAGCAAAGAGGAAATCAAAGATTTTTTGCAAAGT
AAATAAAGTTAAATAACTTCTAACTAAATTTAGCAATCTATAAACTTTCTATCATAATAT
GGCTACCATGTAGTTTAATTGATAGATTCTGGAAGTTTTGGTATTGTTATGAAAGCTATT
GATTCTTCGAATAGCAAAAGATATGTAGCAATAAAGCTTATCATAGTAACAAATACTGAA
ATTTTAAAAGAAAACATTTAAGAATATTAGAAATGCCTTTTAATTAATCATCCCAACGTC
ATCAAAAATTATTAGTAGCTTTATGATGAAGAGAATGAATGCTTTTTTATCATTACAGAG
TTTTGTTAAAAAGGTAATCTGTTTAACTTTTTTAAACAAAACAATATTAAAAAAGAAGAA
ATTGTTGAAATTTGTGCTTAAATTATTGAAGGTGTTTTAGCTATTCATGATAAAAATATT
ATACACAGCGACTTAAAGCCTTAAAATATTCTTATCAATGATGATGATAAAATAAAAATA
TGTGATTTAGGAATGTCTAAATAACTTTTAGGATCAAAATCTCACACCATTTCCAAAGGT
GGAAGTTTGGATTATATGTCACCAGAATAAATTGAAGGTAAGATTAGTAAATAATCTGAC
ATATATTCAGTTGGATGTATTATTTGCTTTCTTTGTAATGTTAACATATTTGGTTTGAAT
ATGGTTAATATAAAGAAAGGGATATTTCCTCCTATATAGGAAAATTGCTTTAAAGAGTTA
GTTAATTTAGCTTTTAAAATGATGAGTGTAGAGCCTAAAAATAGAATTTAGCTTCAAGAT
TCTTTAGATTAGTTGAAATAGTTTTAGAAGATTAACTCACACAATCAAAAAGGAGAAATT
GTTGTAAAATAGTTTTAAAATGGTGATAGATACGAAGGTGAAGTGAAAGATGGAAAGATG
AATGGAAAAGGGATCTACTACTATAAAGAAGATAATATAAGAAAGAAGTATGAAGGATAG
TGGGTTAATGATAAAAAGGATGGCTTTGGTATTTTGGAATATAAAAGTGGGAATAAGTAT
GAAGGATACTTCAAAAACGATTGTTTTAATGGAAAGGGAATTTACTACTATTATAAAGAA
GGTGATAATAAAATGAAGTATGAAGGATAGTGGGTTAATAATCAAAAAGATGGCTTTGGT
ATTTTGGAATATAAAAGTGGGAATAAGTATGAAGGATAATTCAAAAATGATGATTTTAAT
GGAAAGGGAATCTACTACTATAAACAAGGCGACAATATAAAGAAGTATGAAGGATAGTGG
GCTAGTAATTAAAAAGATGGCTTTGGAATTATGGAATATAAAAATGGGAATAGGTATGAA
GGGTAGTTTAAAAATGGTGAATTTAATGGAAAGGGAATCTTCTACTATAAAGAAGATGAT
ATTAAAAAGAGCTATGATGGATTATGGGTTAATGATAAATAGGAAGGCTTTGGAATTTTA
GAGTATAAAAATGGTACTAAATATGAAGGAAACTTCAAGAATGGGAAAAAGAATGGAAAA
GGAATCTAATTAGATTAAAATGGTTAAAAACTTAATGGTGAGTGGATTGATGATAAATTT
TAAACTAATTGA