Identifiers and Description

Gene Model Identifier

TTHERM_00535430

Standard Name

MRNO40 (Membrane Occupation and Recognition Nexus protein other)

Aliases

PreTt03128 | 69.m00170 | 3718.m00032

Description

Protein with predicted MORN domains localized throughout the protein and/or associated with other domains having a predicted function

Genome Browser (Macronucleus)

GBrowse

Genome Browser (Micronucleus)

GBrowse

Gene Ontology Annotations

No Data fetched for Gene Ontology Annotations

Domains

Gene Expression Profile

  • Tetrahymena Functional Genomics Database:

Change in Gene Expression

TMHMM

TMHMM

Signal Peptide

Signal Peptide Present?: No
Presense Probability: 10.3%

TetraMine Data

TTHERM_00535430

WebApollo

Fullscreen View

Tetrahymena Stock Center

No Data fetched for StockID

Homologs (v.2006 protein sequences)

SourceIdentifierScoreDescription
Tetrahymena borealisEI9_11200.19.997093137033517e-262hypothetical protein (491 aa)
OxytrichaContig5991.0.g705.998752501907352e-124MORN repeat
Stentor CoeruleusSteCoe_366861.2479464629129513e-47
DictyBaseDDB_G03494880.000000000000006000101554955223DDB_G0349488 on chromosome: 2
position 6912714 to 6914186
WormBaseWBGene000021790.0000000029989608248573072locus:jph-1 status:Confirmed
UniProt:Q22667 protein_id
:CAA99924.2

General Information

No Data fetched for General Information

Associated Literature

No Data fetched for Associated Literature

Sequences

>TTHERM_00535430(coding)
ATGGGCTAAGAATGTTCAAATTGCTCTCAGCTACTAAATGATAACAATTAGTATGAGTTA
AAAAATGGAGCTAATTATTAGCAATAACAATAATATAATTATTAATAGCAATAATAATAG
TATTAGTAAAATAAAGAAAACTTTTACTCTGCAAGTCATCAGAATAACCCATCATCGCAT
AATTATGGCAGTTATAACTAATCAGCTTATACTGCAATAGCAGGTAATAACTAACCTGCT
ATTGGTCCTCAATCTACATATCCTGTAAACAAGGATAGCTTAGGCAAAGATGATATGATG
CCTTTAGCGAGACATTACTTTTCTTAAGATGAGAACAGAGAAATAATGGTTAATTAGCAC
AATTTCATCAACTCTAACAAAAGAGAAAAAGGTCCATCTTACAAATTTTAGTCAGGAGCA
GTTTATGAAGGAGAATGGCTAGGGGCTATGAGAGATGGTTATGGAATACAAACATGGCCA
GATGGGGCAAGATATGAAGGTGATTGGGTTTAAAATAAAGCAAATGGTAAAGGTAAATTT
TAGCACGTTGATGGTGATATCTATGAAGGAGAATGGAAAGATGACAAAGCAAACGGTTAT
GGAACATACATTCATGTTAATGGTGCTAAATATGATGGGTAATGGAAGGATGATTTACAG
CATGGGTATGGTGTAGAAACTTGGGCTGATGGATCTAAATATGAAGGATATTACAAAGAA
GGAAAGAAACATGGTAATGGAATTTATACTTGGCCTGATGGATCTAAATACTAAGGAAAT
TGGGAAGATAACAAAATTAGTGGATTCGGTGTTTATACATGGCTTGATGGCAGAAAATAT
GAGGGTATGTGGCTGAATAACAATATGCATGGGAGAGGCACATATACTTGGAAAGATGGT
AGAAAGTATGAAGGAGAATACTAATTTGATAAAAAACATGGATTTGGCATATATCTCTGG
GCAGATGGTAGACAATATGAAGGTTTTTGGAAGTATGGAAAGTAGCATGGGCGTGGTAAG
TATATTTAATAAGACGGAATCATAAAAGTTGGTATTTGGGAAGATGGTAAAAGAATTTCA
TGGATTGATCCTTCAGATATAGAATATGATAACTTTTTGCAACAATGCTAAAACTATTAA
CTATAAAATTAATATGCTTCTAAAAATCCTAGCTACTCACCTACTAAAGAGTAAATATAT
TAAAATGGAGGTAACGATCTGAATGGTTCTTACACTGCCAATAATGCTTATAATTAAAAC
AACAGACTTTAATAATCAGGTAATTACGTCAACAATAACAATAATAATAATAATAATAAC
TATGAATATTATGATCCTAATAACTCCTCTTTACCAGCTAACTCATATTAAGACAAAAAT
TACGGAGGATATAATAATAATAATGGAATTTCAAATAGCATAAATAATTAACCATAAAAC
GAGTATGCAGGATCTTACAATAATTAATACTAATAATAACAATTAGGTAATGGTATTCAA
CAGTTCTATAATTGA


>TTHERM_00535430(protein)
MGQECSNCSQLLNDNNQYELKNGANYQQQQQYNYQQQQQQYQQNKENFYSASHQNNPSSH
NYGSYNQSAYTAIAGNNQPAIGPQSTYPVNKDSLGKDDMMPLARHYFSQDENREIMVNQH
NFINSNKREKGPSYKFQSGAVYEGEWLGAMRDGYGIQTWPDGARYEGDWVQNKANGKGKF
QHVDGDIYEGEWKDDKANGYGTYIHVNGAKYDGQWKDDLQHGYGVETWADGSKYEGYYKE
GKKHGNGIYTWPDGSKYQGNWEDNKISGFGVYTWLDGRKYEGMWLNNNMHGRGTYTWKDG
RKYEGEYQFDKKHGFGIYLWADGRQYEGFWKYGKQHGRGKYIQQDGIIKVGIWEDGKRIS
WIDPSDIEYDNFLQQCQNYQLQNQYASKNPSYSPTKEQIYQNGGNDLNGSYTANNAYNQN
NRLQQSGNYVNNNNNNNNNNYEYYDPNNSSLPANSYQDKNYGGYNNNNGISNSINNQPQN
EYAGSYNNQYQQQQLGNGIQQFYN


>TTHERM_00535430(gene)
ATGGGCTAAGAATGTTCAAATTGCTCTCAGCTACTAAATGATAACAATTAGTATGAGTTA
AAAAATGGAGCTAATTATTAGCAATAACAATAATATAATTATTAATAGCAATAATAATAG
TATTAGTAAAATAAAGAAAACTTTTACTCTGCAAGTCATCAGAATAACCCATCATCGCAT
AATTATGGCAGTTATAACTAATCAGCTTATACTGCAATAGCAGGTAATAACTAACCTGCT
ATTGGTCCTCAATCTACATATCCTGTGTAAGCCTATTCTATTCAACAAATATTCTTACTA
TCATATTATTTAATAATATTTATTCAGCTGAATATTTATATTGTAATAGTAACTTTATCG
TTAATTAATTAAATACTTCTATTAATTTAGAAACAAGGATAGCTTAGGCAAAGATGATAT
GATGCCTTTAGCGAGACATTACTTTTCTTAAGATGAGAACAGAGAAATAATGGTTAATTA
GCACAATTTCATCAACTCTAACAAAAGAGAAAAAGGTCCATCTTACAAATTTTAGTCAGG
AGCAGTTTATGAAGGAGAATGGCTAGGGGCTATGAGAGATGGTTATGGAATACAAACATG
GCCAGGTATTATATTTCAAAGTTAGTTACCTTAAATTAAAAAGTAATTTTTTTGTAATAG
ATGGGGCAAGATATGAAGGTGATTGGGTTTAAAATAAAGCAAATGGTAAAGGTAAATTTT
AGCACGTTGATGGTGATATCTATGAAGGAGAATGGAAAGATGACAAAGCAAACGGTTATG
GAACATACATTCATGTTAATGGTGCTAAATATGATGGGTAATGGAAGGATGATTTACAGC
ATGGGTATGGTGTAGAAACTTGGGCTGATGGATCTAAATATGAAGGATATTACAAAGAAG
GAAAGAAACATGGTAATGGAATTTATACTTGGCCTGATGGATCTAAATACTAAGGAAATT
GGGAAGATAACAAAATTAGTGGATTCGGTAAAATATATATAAATACACTTTATAATGATT
ATTAAAATTTATAATTTATTTTGATATTATAAATTTTAGGTGTTTATACATGGCTTGATG
GCAGAAAATATGAGGTAATAAATAAATAAATAAAAAACTATTCTAATTCTAAGATAATAA
TATAATTTCATTATAAAATAAAAAGGGTATGTGGCTGAATAACAATATGCATGGGAGAGG
CACATATACTTGGAAAGATGGTAGAAAGTATGAAGGAGAATACTAATTTGATAAAAAACA
TGGATTTGGCATATATCTCTGGGCAGATGGTAGACAATATGAAGGTTTTTGGAAGTATGG
AAAGTAGCATGGGCGTGGTAAGTATATTTAATAAGACGGAATCATAAAAGTTGGTATTTG
GGAAGATGGTAAAAGAATTTCATGGATTGATCCTTCAGATATAGAATATGATAACTTTTT
GCAACAATGCTAAAACTATTAACTATAAAATTAATATGCTTCTAAAAATCCTAGCTACTC
ACCTACTAAAGAGTAAATATATTAAAATGGAGGTAACGATCTGAATGGTTCTTACACTGC
CAATAATGCTTATAATTAAAACAACAGACTTTAATAATCAGGTAATTACGTCAACAATAA
CAATAATAATAATAATAATAACTATGAATATTATGATCCTAATAACTCCTCTTTACCAGC
TAACTCATATTAAGACAAAAATTACGGAGGATATAATAATAATAATGGAATTTCAAATAG
CATAAATAATTAACCATAAAACGAGTATGCAGGATCTTACAATAATTAATACTAATAATA
ACAATTAGGTAATGGTATTCAACAGTTCTATAATTGA