Identifiers and Description

Gene Model Identifier

TTHERM_00685930

Standard Name

MRNO36 (Membrane Occupation and Recognition Nexus protein other 36)

Aliases

PreTt18207 | 104.m00139 | 3732.m00052

Description

Protein with predicted MORN domains localized throughout the protein and/or associated with other domains having a predicted function; IQ calmodulin-binding motif family protein

Genome Browser (Macronucleus)

GBrowse

Genome Browser (Micronucleus)

GBrowse

Gene Ontology Annotations

No Data fetched for Gene Ontology Annotations

Domains

Gene Expression Profile

  • Tetrahymena Functional Genomics Database:

Change in Gene Expression

TMHMM

TMHMM

Signal Peptide

Signal Peptide Present?: No
Presense Probability: 10.1%

TetraMine Data

TTHERM_00685930

WebApollo

Fullscreen View

Tetrahymena Stock Center

No Data fetched for StockID

Homologs (v.2006 protein sequences)

SourceIdentifierScoreDescription
Tetrahymena borealisEI9_17378.19.997093137033517e-262IQ calmodulin-binding domain-c
ontaining protein family prote
in (353 aa)
OxytrichaContig3828.0.g199.998819815181669e-76MORN repeat
Stentor CoeruleusSteCoe_164044.906094730649281e-35
DictyBaseDDB_G03494887.000255027549774e-17DDB_G0349488 on chromosome: 2
position 6912714 to 6914186
WormBaseWBGene000021790.000000000010004361180063202locus:jph-1 status:Confirmed
UniProt:Q22667 protein_id
:CAA99924.2

General Information

No Data fetched for General Information

Associated Literature

  1. Ref:SUPR000327

Sequences

>TTHERM_00685930(coding)
ATGGGAAGTTGCTAATCCGATTGCCGTGATAAATAGGAAATTGATCCTTATAATGTTCCA
AAAGAATAAGAACCATTAAAATTAGAAGATGCAGAATCTTAATAAAAAATTATTAAAATA
TAATCCTTCGCAAGAGGATACAAAGCTAAATAGGAAGTTTAAGAGCTGAAGAAATAAGTT
AACAGTAATGCTCCACCAAGAGAAGTTGCTCTTCCTTACGAAGGTCCTATGGCAACTGAT
AAACTCTAAGTATAAAAAATTTTGAATGATAAATTTAATTGGCCTGCAAGACCTGAATTC
AAGGAATTTATTCGCCTTCCTCCTTTTAAATTTATATAATCTGGTGCCATCTACAAAGGT
TAATGGAATAATGGTTTAAGACATGGAAGAGGTATATAATTTTGGCCAGATGGCTCTGTT
TATTAAGGTGATTGGGTCGAGGATATGGCAGATGGTAAAGGTAGACTCATTCATCCTGAT
GGAGATTACTACTAAGGTGATTGGTAAAAAGATCGCGCATAAGGCATAGGTATTTTTGTT
CACGTAGATGGAAATAAATATGAAGGTGAATGGTATTAAGATAAGTAACATGGCTAGGGA
GTAGAAGAATAGCAAGATTTTATTTATCGTGGTAGCTTCTAAAATGGCTTAAAGCATGGA
AAGGGAAAGATTATTTGGAAAAATGATGGAACTTCATACGAAGGTGATTTCTATGAAGGC
TTGATGGAAGGTACTGGTAGATTTATTTTCTAAAATGGAAAAATCTATAATGGTTAATGG
TTCAAATCTAAAATGCATGGACATGGAGAACTTATTTATCCTGATGGAAGAAAATATACA
GGAAGCTTTGTTGAAGGATAAAAAAATGGATTGGGTAAAATGGAATATCCAGATGGTAAA
ATTTATGAAGGTGAATGGAAAAATGGAAAATAGCATGGCCAAGGCTAGGTAACAACTCCA
GATGGTAGAATAGGTTAGGGTTACTGGGAAGAGGGCAAAAGAGTTAAGAATTACGATTAA
ATGAACTAATAACATTAAGAAGTAGGACTCTGA


>TTHERM_00685930(protein)
MGSCQSDCRDKQEIDPYNVPKEQEPLKLEDAESQQKIIKIQSFARGYKAKQEVQELKKQV
NSNAPPREVALPYEGPMATDKLQVQKILNDKFNWPARPEFKEFIRLPPFKFIQSGAIYKG
QWNNGLRHGRGIQFWPDGSVYQGDWVEDMADGKGRLIHPDGDYYQGDWQKDRAQGIGIFV
HVDGNKYEGEWYQDKQHGQGVEEQQDFIYRGSFQNGLKHGKGKIIWKNDGTSYEGDFYEG
LMEGTGRFIFQNGKIYNGQWFKSKMHGHGELIYPDGRKYTGSFVEGQKNGLGKMEYPDGK
IYEGEWKNGKQHGQGQVTTPDGRIGQGYWEEGKRVKNYDQMNQQHQEVGL


>TTHERM_00685930(gene)
ATGGGAAGTTGCTAATCCGATTGCCGTGATAAATAGGAAATTGATCCTTATAATGTTCCA
AAAGAATAAGAACCATTAAAATTAGAAGATGCAGAATCTTAATAAAAAATTATTAAAATA
TAATCCTTCGCAAGAGGATACAAAGCTAAATAGGAAGTTTAAGAGCTGAAGAAATAAGTT
AACAGTAATGCTCCACCAAGAGAAGTTGCTCTTCCTTACGAAGGTCCTATGGCAACTGAT
AAACTCTAAGTATAAAAAATTTTGAATGATAAATTTAATTGGCCTGCAAGACCTGAATTC
AAGGAATTTATTCGCCTTCCTCCTTTTAAATTTATATAATCTGGTGCCATCTACAAAGGT
TAATGGAATAATGGTTTAAGACATGGAAGAGGTATATAATTTTGGCCAGATGGCTCTGTT
TATTAAGGTGATTGGGTCGAGGATATGGCAGATGGTAAAGGTAGACTCATTCATCCTGAT
GGAGATTACTACTAAGGTGATTGGTAAAAAGATCGCGCATAAGGCATAGGTAATTTTTTT
TCCATAAAAATGGAAAATTTAAACGCAAAGTTCAATATTCTATTAAGAGAATAAGATTAA
AAACTTATAAATGATATTAATATTTCATAAAAATCAAAAGAAAGGCATTTATTTCACTTT
ATTTTAAATTTTTTTGATATTTTATTCAGCCTTTATTTAAGTTTCAAAGATATAAAAATT
TTAAAATAGAAAAAATAATATGTTTGTTTAAGAGCATATTTTTTTACCTAATGCACATTC
TCTTACTTTTTGCTTCTATTTTCTATTCTCGTTTAAAATTTTTCAGCTTTCTTTACTCAA
CTTTTTAAATATATAATTTTATTTAAAATTAGGTATTTTTGTTCACGTAGATGGAAATAA
ATATGAAGGTGAATGGTATTAAGATAAGTAACATGGCTAGGGAGTAGAAGAATAGCAAGA
TTTTATTTATCGTGGTAGCTTCTAAAATGGCTTAAAGCATGGAAAGGGAAAGATTATTTG
GAAAAATGATGGAACTTCATACGAAGGTGATTTCTATGAAGGCTTGATGGAAGGTACTGG
TAGATTTATTTTCTAAAATGGAAAAATCTATAATGGTTAATGGTTCAAATCTAAAATGCA
TGGACATGGAGAACTTATTTATCCTGATGGAAGAAAATATACAGGTATATTAATTTCCTT
TTTCTTCTTAAAATATTTAGTTTTATATATTTTTAATTAGGAAGCTTTGTTGAAGGATAA
AAAAATGGATTGGGTAAAATGGAATATCCAGATGGTAAAATTTATGAAGGTGAATGGAAA
AATGGAAAATAGCATGGCCAAGGCTAGGTAACAACTCCAGATGGTAGAATAGGTTAGGGT
TACTGGGAAGAGGGCAAAAGAGTTAAGAATTACGATTAAATGAACTAATAACATTAAGAA
GTAGGACTCTGA