Identifiers and Description

Gene Model Identifier

TTHERM_00384820

Standard Name

MRNO35 (Membrane Occupation and Recognition Nexus protein other)

Aliases

PreTt24774 | 41.m00181

Description

MORN motif protein

Genome Browser (Macronucleus)

GBrowse

Genome Browser (Micronucleus)

GBrowse

Gene Ontology Annotations

No Data fetched for Gene Ontology Annotations

Domains

Gene Expression Profile

  • Tetrahymena Functional Genomics Database:

Change in Gene Expression

TMHMM

TMHMM

Signal Peptide

Signal Peptide Present?: No
Presense Probability: 10.5%

TetraMine Data

TTHERM_00384820

WebApollo

Fullscreen View

Tetrahymena Stock Center

No Data fetched for StockID

Homologs (v.2006 protein sequences)

SourceIdentifierScoreDescription
Tetrahymena borealisEI9_04398.19.997093137033517e-262hypothetical protein (759 aa)
OxytrichaContig5991.0.g702.9998512931988133e-83MORN repeat
Stentor CoeruleusSteCoe_57444.906094730649281e-35
DictyBaseDDB_G03494880.00000000000001000191320216021DDB_G0349488 on chromosome: 2
position 6912714 to 6914186
WormBaseWBGene000021790.0000000010002658722841845locus:jph-1 status:Confirmed
UniProt:Q22667 protein_id
:CAA99924.2

General Information

No Data fetched for General Information

Associated Literature

No Data fetched for Associated Literature

Sequences

>TTHERM_00384820(coding)
ATGGGAAACGAGTGTTCAAACTGTGTGAATGAAAGAGTGGATAAAAAGAAGTAATGGGAT
TATGATAATCAATTTTAGGAAAACAATCAAAATTTTAGATAATAATATAATAACAGTGAT
ACATATACTCCATATTAATAAAATGTTCATAATTAAATAGGAGATATTCAATATAATAAT
GGTAATTAAATTTTTAATAAGAGCTAGAATAATAGGCCATATGTTAATCCTCAGAATTAG
AATATGCTTGAAAATGGTACTCCTTATAATAATCCAAATTAATCCTAGTAAAATATGAAT
CGGTATAGTTAAAATATTCAAAATTATTAGCATAATTAAAAAAGTGATTTTGAAAAAAAT
GGTTTCCAAGGAGCTTATAAATAAAATAGCGTTAATAGTACTATTGATATAAATAATGGC
TATTTACATTCAAATATTTCTAATCAATAAATTAACAGCTCAACAAATATATCTAAGCCT
ACTAACTAATCATTTGGAGGATAATTAATTTAAGAAAAGTCTATTGAAAAAAGTTATGAT
TAATCAATACAACCTTTTGATTAACTGATAGAAAGAGAGCCTATCGAGTTAGAAAATGAT
GGTATTTATTAAGGTTAGTGGAGAGGAGATTTAAGAGAAGGATTTGGTAAATAAAAATGG
AAAAATGGAGCTTACTATGAAGGATTCTGGAAATAAGATAATGCAGATGGGAAAGGAATA
TTTATACATCCTAATGGAGATAAATACGAAGGTGAATGGAAAGATAACAAGGCTAATGGA
AAAGGTAAATATACTCATGTAGATGGTTCAATTTACGATGGTGAATGGAAAAATGATTAT
AAAGACGGATACGGAATAGAAACTTGGGCTAATAAATCTAGATATGAAGGCTATTATTCA
AAAGGGAAAAAGCATGGTATAGGGAGATTCTATTGGTATAACGGTTCATCTTATGATGGA
AACTGGTCCATGGATTAGCTAAACGGCTTTGGAGTTTATACTTGGAAAGATGGGAGAATT
TATAAAGGTTATTGGAAAGATAATTTCATGCATGGAAGAGGTAAATACTCCTGGGCAGAT
GGTAGATATTATGATGGTGAATATCAAAATGATAAGAAGCATGGATTTGGAGTTTATGTT
TGGATAGATCAAAAAAGATATGAGGGGTTTTGGTATAAAGGTAAATAACATGGTAAAGGA
AAATTCGTATATCCTTCTGGTTAAATTAAGTATGTTTTATACAATCATGGCAAACAAAAG
CAATTAACAATAGAAGAATATAATTAGATTAGTGATGATATTTCAGAAGGTGAATTGTAG
TTTTATTTTAACTAGCAAGATGGAGAAAAAAGTAATCACGATGTTTCAATAAACTAGGCA
GAAAGTATGTAAGTTAGTACTTAATTTAAATAGAGTGATTGGGAAACAAGAAGACCAGAA
TTAGTTTAAGTTTCTGAAAATGCTAGTTAAAATAATTACTTTAAGAATAATGGAAAAATG
ATATAAAACTAGTAAGAAAAAGTATTATAGCATAACTAAAGTTAAAATGAATTAAACTAA
AGAAAAGATCCTATTTAATAAGAGAAATAGATAAATTAAAGTAATAGTCAAAGATAGCTT
GATTTATAGAGCTATTAGTAAAATGGCTTAAAATAAAATTTTTCAACTCAAAATTTAAAC
AACATACAATAAATTCAGTAAATTGAATTTAGCAACGAACAAAAACGTTAATCTTATCAA
GTAGAGCAGCAATAAGAGTAATTAATAGCAAAAAATGCTGTAAATTAGAATTAATAAATA
TAAAATTAATATAACTAGCATAATTAATAATAAAATGCTTTTACTTATGAAAATGGACTT
TCAAAAAATTAATCAACTTAAGATAATTAAGACAGTTCTCTAAAGGTGCCTGTCATAAAA
AATGTAGAATCCTAAATGCAAATGGCAACTGAATCTAGTTAGCAATTAGGAATGTATTAA
GATTATTAGTAAAACAACCCATAAATATTGAGATCTTCATATAGAAGCTAATCTTAAAAA
AAGAAAAATAATAATGACCCCTTAATTGCTTCAGGTAAAGTTATTTTACCTGCTAGCTAG
CAGCAGCAACTTTAAAGCAAGATTTAAGGATCTAACAAATCTCCAGAAAGAATTTATGAA
TAAAGGTAACAATATTGA


>TTHERM_00384820(protein)
MGNECSNCVNERVDKKKQWDYDNQFQENNQNFRQQYNNSDTYTPYQQNVHNQIGDIQYNN
GNQIFNKSQNNRPYVNPQNQNMLENGTPYNNPNQSQQNMNRYSQNIQNYQHNQKSDFEKN
GFQGAYKQNSVNSTIDINNGYLHSNISNQQINSSTNISKPTNQSFGGQLIQEKSIEKSYD
QSIQPFDQLIEREPIELENDGIYQGQWRGDLREGFGKQKWKNGAYYEGFWKQDNADGKGI
FIHPNGDKYEGEWKDNKANGKGKYTHVDGSIYDGEWKNDYKDGYGIETWANKSRYEGYYS
KGKKHGIGRFYWYNGSSYDGNWSMDQLNGFGVYTWKDGRIYKGYWKDNFMHGRGKYSWAD
GRYYDGEYQNDKKHGFGVYVWIDQKRYEGFWYKGKQHGKGKFVYPSGQIKYVLYNHGKQK
QLTIEEYNQISDDISEGELQFYFNQQDGEKSNHDVSINQAESMQVSTQFKQSDWETRRPE
LVQVSENASQNNYFKNNGKMIQNQQEKVLQHNQSQNELNQRKDPIQQEKQINQSNSQRQL
DLQSYQQNGLKQNFSTQNLNNIQQIQQIEFSNEQKRQSYQVEQQQEQLIAKNAVNQNQQI
QNQYNQHNQQQNAFTYENGLSKNQSTQDNQDSSLKVPVIKNVESQMQMATESSQQLGMYQ
DYQQNNPQILRSSYRSQSQKKKNNNDPLIASGKVILPASQQQQLQSKIQGSNKSPERIYE
QRQQY


>TTHERM_00384820(gene)
ATGGGAAACGAGTGTTCAAACTGTGTGAATGAAAGAGTGGATAAAAAGAAGTAATGGGAT
TATGATAATCAAGTAAATTTAATATTTTAAATAAATTTTTTGTAATAAAATGTTATGATT
GTTCAAGTTTTAGGAAAACAATCAAAATTTTAGATAATAATATAATAACAGTGATACATA
TACTCCATATTAATAAAATGTTCATAATGTAAATTGATTTATTCATTCTAGTACTTACTT
GCCTAAACTTATTTGTTTTTGCAGTAAATAGGAGATATTCAATATAATAATGGTAATTAA
ATTTTTAATAAGAGCTAGAATAATAGGCCATATGTTAATCCTCAGAATTAGAATATGCTT
GAAAATGGTACTCCTTATAATAATCCAAATTAATCCTAGTAAAATATGAATCGGTATAGT
TAAAATATTCAAAATTATTAGCATAATTAGTAAAAATTATTTAAACAACATCTGTTTTTA
AAGTTTTTTAACTAAAAAATAGAAAAAGTGATTTTGAAAAAAATGGTTTCCAAGGAGCTT
ATAAATAAAATAGCGTTAATAGTACTATTGATATAAATAATGGCTATTTACATTCAAATA
TTTCTAATCAATAAATTAACAGCTCAACAAATATATCTAAGCCTACTAACTAATCATTTG
GAGGATAATTAATTTAAGAAAAGTCTATTGAAAAAAGTTATGATTAATCAATACAACCTT
TTGATTAACTGATAGAAAGAGAGCCTATCGAGTTAGAAAATGATGGTATTTATTAAGGTT
AGTGGAGAGGAGATTTAAGAGAAGGATTTGGTAAATAAAAATGGTAAATTTAATTTAATT
TATTAAAAAGTTAAAATCTTATAATACTTATAAAGGAAAAATGGAGCTTACTATGAAGGT
ATTGAAGTTTTAAAAGATTTCTAATTTGATATATCAAAACATTATTAGGATTCTGGAAAT
AAGATAATGCAGATGGGAAAGGAATATTTATACATCCTAATGGAGATAAATACGAAGGTT
TGAAATATATTTATTTTAAAATAAGAATTTAATAAGATTTGCTTTTAATATTTTAATTAG
GTGAATGGAAAGATAACAAGGCTAATGGAAAAGGTAAATATACTCATGTAGATGGTTCAA
TTTACGATGGTGAATGGAAAAATGATTATAAAGACGGATACGGAATAGAAACTTGGTAAT
ATCTAATAAATTTATTTTGATAGTTTTCATATTAAGAAAGAAAATAGTAGAAGAATGAAT
TTTAACTTATCTTAATATTTTTTTTTAAAGGGCTAATAAATCTAGATATGAAGGCTATTA
TTCAAAAGGGAAAAAGCATGGTATAGGGAGATTCTATTGGTATAACGGTTCATCTTATGA
TGGAAACTGGTCCATGGATTAGCTAAACGGCTTTGTAATTTTTTAGAAATGTAAACAATA
TCAATAATTTTTAATTTTTCAAGGGAGTTTATACTTGGAAAGATGGGAGAATTTATAAAG
GTAATAAATATAAAATTCAAGCATAAATAAACAGTATTATTAATAATTAAATTAGGTTAT
TGGAAAGATAATTTCATGCATGGAAGAGGTAAATACTCCTGGGCAGATGGTAGATATTAT
GATGGTGAATATCAAAATGATAAGAAGCATGGATTTGGAGTTTATGTTTGGATAGGTAAA
TAAATTAATTAGTGAGATAAAGATTTTGTAATAATGATTAATTAAAAGATCAAAAAAGAT
ATGAGGGGTTTTGGTATAAAGGTAAATAACATGGTAAAGGAAAATTCGTATATCCTTCTG
GTTAAATTAAGTATGTTTTATACAATCATGGCAAACAAAAGCAATTAACAATAGAAGAAT
ATAATTAGATTAGTGATGATATTTCAGAAGGTGAATTGTAGTTTTATTTTAACTAGCAAG
ATGGAGAAAAAAGTAATCACGATGTTTCAATAAACTAGGCAGAAAGTATGTAAGTTAGTA
CTTAATTTAAATAGAGTGATTGGGAAACAAGAAGACCAGAATTAGTTTAAGTTTCTGAAA
ATGCTAGTTAAAATAATTACTTTAAGAATAATGGAAAAATGATATAAAACTAGTAAGAAA
AAGTATTATAGCATAACTAAAGTTAAAATGAATTAAACTAAAGAAAAGATCCTATTTAAT
AAGAGAAATAGATAAATTAAAGTAATAGTCAAAGATAGCTTGATTTATAGAGCTATTAGT
AAAATGGCTTAAAATAAAATTTTTCAACTCAAAATTTAAACAACATACAATAAATTCAGT
AAATTGAATTTAGCAACGAACAAAAACGTTAATCTTATCAAGTAGAGCAGCAATAAGAGT
AATTAATAGCAAAAAATGCTGTAAATTAGAATTAATAAATATAAAATTAATATAACTAGC
ATAATTAATAATAAAATGCTTTTACTTATGAAAATGGACTTTCAAAAAATTAATCAACTT
AAGATAATTAAGACAGTTCTCTAAAGGTGCCTGTCATAAAAAATGTAGAATCCTAAATGC
AAATGGCAACTGAATCTAGTTAGCAATTAGGAATGTATTAAGATTATTAGTAAAACAACC
CATAAATATTGAGATCTTCATATAGAAGCTAATCTTAAAAAAAGAAAAATAATAATGACC
CCTTAATTGCTTCAGGTAAAGTTATTTTACCTGCTAGCTAGCAGCAGCAACTTTAAAGCA
AGATTTAAGGATCTAACAAATCTCCAGAAAGAATTTATGAATAAAGGTAACAATATTGA