Identifiers and Description

Gene Model Identifier

TTHERM_00125250

Standard Name

MRNO34 (Membrane Occupation and Recognition Nexus protein other)

Aliases

PreTt09287 | 9.m00308 | 3699.m00018

Description

Protein with predicted MORN domains localized throughout the protein and/or associated with other domains having a predicted function. Protein kinase domain containing protein.

Genome Browser (Macronucleus)

GBrowse

Genome Browser (Micronucleus)

GBrowse

Gene Ontology Annotations

Molecular Function

Biological Process

Domains

Gene Expression Profile

  • Tetrahymena Functional Genomics Database:

Change in Gene Expression

TMHMM

TMHMM

Signal Peptide

Signal Peptide Present?: No
Presense Probability: 10%

TetraMine Data

TTHERM_00125250

WebApollo

Fullscreen View

Tetrahymena Stock Center

No Data fetched for StockID

Homologs (v.2006 protein sequences)

SourceIdentifierScoreDescription
Tetrahymena borealisEI9_02462.11.0004249259458435e-52hypothetical protein (771 aa)
OxytrichaContig12671.0.g775.00094715178354e-25MORN repeat
DictyBaseDDB_G02866270.000000000004997916451710233DDB_G0286627 on chromosome: 4
position 4756048 to 4758163
Stentor CoeruleusSteCoe_164040.00000000003775134544279098
WormBaseWBGene000203240.0000000000599805963605737status:Confirmed UniProt:Q22
324 protein_id:CCD70852.1
SGDYPL204W0.000000007998594485613997HRR25 Protein kinase involved
in regulating diverse events i
ncluding vesicular trafficking
, DNA repair, and chromosome s
egregation; binds the CTD of R
NA pol II; homolog of mammalia
n casein kinase 1delta (CK1del
ta)

General Information

No Data fetched for General Information

Associated Literature

  1. Ref:16933976: Eisen JA, Coyne RS, Wu M, Wu D, Thiagarajan M, Wortman JR, Badger JH, Ren Q, Amedeo P, Jones KM, Tallon LJ, Delcher AL, Salzberg SL, Silva JC, Haas BJ, Majoros WH, Farzad M, Carlton JM, Smith RK, Garg J, Pearlman RE, Karrer KM, Sun L, Manning G, Elde NC, Turkewitz AP, Asai DJ, Wilkes DE, Wang Y, Cai H, Collins K, Stewart BA, Lee SR, Wilamowska K, Weinberg Z, Ruzzo WL, Wloga D, Gaertig J, Frankel J, Tsao CC, Gorovsky MA, Keeling PJ, Waller RF, Patron NJ, Cherry JM, Stover NA,

Sequences

>TTHERM_00125250(coding)
ATGGGTTCCAATATTTTTTCTAAGGATGTTTCTATTAATTAAATAGATGACAAAATTACA
ATGTTCTTATAACAAAAATAATTTAAAATAGAAAAATATTTAGATTAAGGTTATTTTGCT
GAAGTATTTTAAGCTATTAAGATTGATGATAATCGTAGAGTTGTGATAAAAAAATTAAAG
GATCTAAACAACTTGAAAAAAATTGAAGACGAAAAGAATGCAATGTACAAGATATAGAAT
GAACAGTATGCTATCTAAATTATAACAGACTTAGTTGATAAAGATCTTGAATATAACGCC
ATAGTAATGGAACTTTGTGATTGTAATCTCACTGAAATTTTTGAAAATAATATATCTAAT
TTTTCGTTTGAATAGCTAGTCACATTAACCTACCAGCTCTTAAAAGGTTTATTAGTTTTT
TAAGAGAAAGGTATTATACATGGTGATCTTAAACCTGAAAACATTTTATACAGCCAATAA
AAAAATAGATTTTTAATATCTGATCTTGGACTTAGTTAAGTTATGTAAAATCCTGAGCTT
TAATAACTAATTAGCAAGCAATCGAATTCATTAGTAGGAAACATCAAATACATGGCTCCA
GAAATTATTCATTAAAGAAAACCCTAACAATTAAAATTGATGTTTTTTCAATAGGATAAA
TTCTCCTTGAGTTCACTTTAAAAAGGGAATTAACTTTATCAGAGTATTTTATGGTATGTC
CTGAAACTTCTAAAAGATTAGAATCTTTAACATTACTTCAAAGATATTGGTGATTACTAC
CAAGGCTATTAGGTGCCTGGTCTCTCATGTAAGTTAGCAAAATTTTTTTATCCTACTGGT
GCTATTTACGAAGGATAAGTCAAGGATAGTAAGAGGCATGGATTAGGAAAATATACATAT
TCTAACGGGAATGTATATGAAGGAGATTGGTTTGAAAATAAATAAAATGGTGAAGGTAGA
TTTGTGTATGCTGAGAAAAGTGGTGAAGGAGGCGATATATATAATGGATAATTTAAAGAT
GATAAATTTGAAGGATTTGGTCATTACTATTATAAAAAAAGTGGTAGGCAATATATTGGT
TTCTTTTCTAATGATAAATGGAATGGCGAAGGTAAATTTATAAATGCTAATGGTGAAATT
ATTAAAAGTGGTATTTGGAAAGATGATAAACTTCAAACTGATATGAATGTAGCTGAAATA
GTTACCCCCAAGCAGTTCTAACATTTAATTATTGAAAATTTTGAATAAAAAAAAGATATC
TTGAATTAATTAGGGATGAAAGATTTTTACTTTGAAGGAAATTATTAAAAACTGAATCCC
TAGTGTAAATATGCAAAAATATATTATGATAATGGTATATATGAAGGATCAATCCAAAAT
GGTAAGAAATAAGGAATTGGAAAATTTATGTTTGCTAATGGCAATGTATATGTCGGAAAT
TGGTTTGAAAATCAATAAAATGGCTAAGGTAGATTTATGTTTGATGGTTTAGATAGTGAT
ATATACAATGGAGAGTTTAAAAAGGGTAAATTTGAAGGCTTTGGTCACTATTATTATAAT
AAAAGTGGTAAGCAATATATTGGTTTCTTTTCTAATGACAAATGGAATGGCTAAGGTAAA
TTTATCAGTGCTAATGGTGAGATTATTAAAAGTGGTATTTGGAAAGATGATAAACTTGAA
ACTGATATGAATAAAGCTGATATTCTAGTTCCCAATTAATTCAAGCATTTAATCATACAA
TTTTGA


>TTHERM_00125250(protein)
MGSNIFSKDVSINQIDDKITMFLQQKQFKIEKYLDQGYFAEVFQAIKIDDNRRVVIKKLK
DLNNLKKIEDEKNAMYKIQNEQYAIQIITDLVDKDLEYNAIVMELCDCNLTEIFENNISN
FSFEQLVTLTYQLLKGLLVFQEKGIIHGDLKPENILYSQQKNRFLISDLGLSQVMQNPEL
QQLISKQSNSLVGNIKYMAPEIIHQRKPQQLKLMFFQQDKFSLSSLQKGNQLYQSILWYV
LKLLKDQNLQHYFKDIGDYYQGYQVPGLSCKLAKFFYPTGAIYEGQVKDSKRHGLGKYTY
SNGNVYEGDWFENKQNGEGRFVYAEKSGEGGDIYNGQFKDDKFEGFGHYYYKKSGRQYIG
FFSNDKWNGEGKFINANGEIIKSGIWKDDKLQTDMNVAEIVTPKQFQHLIIENFEQKKDI
LNQLGMKDFYFEGNYQKLNPQCKYAKIYYDNGIYEGSIQNGKKQGIGKFMFANGNVYVGN
WFENQQNGQGRFMFDGLDSDIYNGEFKKGKFEGFGHYYYNKSGKQYIGFFSNDKWNGQGK
FISANGEIIKSGIWKDDKLETDMNKADILVPNQFKHLIIQF


>TTHERM_00125250(gene)
ATGGGTTCCAATATTTTTTCTAAGGATGTTTCTATTAATTAAATAGATGACAAAATTACA
ATGTTCTTATAACAAAAATAATTTAAAATAGAAAAATATTTAGATTAAGGTTATTTTGCT
GAAGTATTTTAAGCTATTAAGATTGATGATAATCGTAGAGTTGTGATAAAAAAATTAAAG
GATCTAAACAACTTGAAAAAAATTGAAGACGAAAAGAATGCAATGTACAAGATATAGAAT
GAACAGTATGCTATCTAAATTATAACAGACTTAGTTGATAAAGATCTTGAATATAACGCC
ATAGTAATGGAACTTTGTGATTGTAATCTCACTGAAATTTTTGAAAATAATATATCTAAT
TTTTCGTTTGAATAGCTAGTCACATTAACCTACCAGCTCTTAAAAGGTTTATTAGTTTTT
TAAGAGAAAGGTATTATACATGGTGATCTTAAACCTGAAAACATTTTATACAGCCAATAA
AAAAATAGATTTTTAATATCTGATCTTGGACTTAGTTAAGTTATGTAAAATCCTGAGCTT
TAATAACTAATTAGCAAGCAATCGAATTCATTAGTAGGAAACATCAAATACATGGCTCCA
GAAATTATTCATTAAAGAAAACCCTAACAATTAAAATTGATGTTTTTTCAATAGGATAAA
TTCTCCTTGAGTTCACTTTAAAAAGGGAATTAACTTTATCAGAGTGTTTAAAATTAAAAG
AAAATAATTTATTTGAAATAATACCAGAATTAAAAACTAATTAGAATATAAAATTTATAG
AATAAATACTAGATTTTATGGTATGTCCTGAAACTTCTAAAAGATTAGAATCTTTAACAT
TACTTCAAAGGTTATATTAATTTAAAAGTAATGAAGAATCTCTGAAGACTTTAGTTTTTT
CTAATAAATCACAGCAGCTAATAGAATAGAATAAATCTAATATCTAATATTAAAAAACAG
ATATTGGTGATTACTACCAAGGCTATTAGGTGCCTGGTCTCTCATGTAAGTTAGCAAAAT
TTTTTTATCCTACTGGTGCTATTTACGAAGGATAAGTCAAGGATAGTAAGAGGCATGGAT
TAGGAAAATATACATATTCTAACGGGAATGTATATGAAGGAGATTGGTTTGAAAATAAAT
AAAATGGTGAAGGTAGATTTGTGTATGCTGAGAAAAGTGGTGAAGGAGGCGATATATATA
ATGGATAATTTAAAGATGATAAATTTGAAGGATTTGGTCATTACTATTATAAAAAAAGTG
GTAGGCAATATATTGGTTTCTTTTCTAATGATAAATGGAATGGCGAAGGTAAATTTATAA
ATGCTAATGGTGAAATTATTAAAAGTGGTATTTGGAAAGATGATAAACTTCAAACTGATA
TGAATGTAGCTGAAATAGTTACCCCCAAGCAGTTCTAACATTTAATTATTGAAAATTTTG
AATAAAAAAAAGATATCTTGAATTAATTAGGGATGAAAGATTTTTACTTTGAAGGAAATT
ATTAAAAACTGAATCCCTAGTGTAAATATGCAAAAATATATTATGATAATGGTATATATG
AAGGATCAATCCAAAATGGTAAGAAATAAGGAATTGGAAAATTTATGTTTGCTAATGGCA
ATGTATATGTCGGAAATTGGTTTGAAAATCAATAAAATGGCTAAGGTAGATTTATGTTTG
ATGGTTTAGATAGTGATATATACAATGGAGAGTTTAAAAAGGGTAAATTTGAAGGCTTTG
GTCACTATTATTATAATAAAAGTGGTAAGCAATATATTGGTTTCTTTTCTAATGACAAAT
GGAATGGCTAAGGTAAATTTATCAGTGCTAATGGTGAGATTATTAAAAGTGGTATTTGGA
AAGATGATAAACTTGAAACTGATATGAATAAAGCTGATATTCTAGTTCCCAATTAATTCA
AGCATTTAATCATACAATTTTGA