Identifiers and Description

Gene Model Identifier

TTHERM_00575440

Standard Name

MRNO32 (Membrane Occupation and Recognition Nexus protein other)

Aliases

PreTt28934 | 77.m00146 | 3812.m02629

Description

Protein with predicted MORN domains localized throughout the protein and/or associated with other domains having a predicted function

Genome Browser (Macronucleus)

GBrowse

Genome Browser (Micronucleus)

GBrowse

Gene Ontology Annotations

Cellular Component

Molecular Function

  • calcium-dependent cysteine-type endopeptidase activity (IEA) | GO:0004198

Biological Process

Domains

No Data fetched for Domains

Gene Expression Profile

  • Tetrahymena Functional Genomics Database:

Change in Gene Expression

TMHMM

TMHMM

Signal Peptide

Signal Peptide Present?: No
Presense Probability: 10.2%

TetraMine Data

TTHERM_00575440

WebApollo

Fullscreen View

Tetrahymena Stock Center

No Data fetched for StockID

Homologs (v.2006 protein sequences)

SourceIdentifierScoreDescription
Tetrahymena borealisEI9_04011.19.997093137033517e-262hypothetical protein (1124 aa)
OxytrichaContig16070.0.g1039.995317835403734e-19MORN repeat
DictyBaseDDB_G03494880.00000000000020009182674645818DDB_G0349488 on chromosome: 2
position 6912714 to 6914186
WormBaseWBGene000021790.0000000006999585478469937locus:jph-1 status:Confirmed
UniProt:Q22667 protein_id
:CAA99924.2

General Information

No Data fetched for General Information

Associated Literature

No Data fetched for Associated Literature

Sequences

>TTHERM_00575440(coding)
ATGGAGGTTGAAAGTAAGGTGTAGAGCTAAGGGAAGGATCAAAGATATCAAAATGAAGTT
TCTTATGGAAAAAGAAAGTATGTTGGTTAGTTTTTGAATGGAAAGCGTGACGGAAAAGGC
AAAGAAGAAGATAAAACTAACCATACCTTATATGAAGGTAACTTTTAAGATGATATGTAT
CATGGTATAGGTACACTCTATCAACTATAAACAAAGTGCTATTTTAAGGGAATATTTGAA
AAAAATTAGAAGAAAGCAGGCATTGAAATCTTTCCAAACGGTGATGTTTATGAAGGTGAG
TACAAAGATGATTAATTCCATGGTAAAGGATATCTCAGAAATAGAGATTTATTCTATTTT
ATAGATGATGGTAAATCTTCTTAGTAGGTTAACGATTAAAAAAAAGTTTAATCAACATAC
TCTTATGAAGGCACCTTTTAGAATGGTAAAAAAGATGGTTTCGGCACTGAAAGGTATATT
AAAGGCGCTGTTTATGTAGGTGAATTTAGAAATAATTAAAAACATGGTAAAGGCAAGCTT
TAGTATCCAGATGGTAGCTATTATGAAGGAGACTTTGTGAATGGTGTTCCCTGTGGGTTT
GGTGTTCATTGTGCCTACTCAGTAGAATAGATATAAAGCATAAAACCAATTAAAAAAGGA
GCCACAAATAATAGCAAAGCAAATGAAAGGTTATAAAGAAATATTTAATTGAAGGAATCC
TTAGCAATTAATAGTTTGCAAGATATTGATAGCAGCTAACAATTAATCCAAAAGGAAGAT
GAAAAAGAAAACTATTAAATGAGCTATTTTGATGAAAAACCTGAATTTTACTATGAAGGT
GAGTTTATGGAAGGTTTTAAGCATGGAAAGGGAAGGTTTTATTTTCCAGACGGTTCGTAT
TATTATTGCCAGTGGGCTTTCAATAAAAAAGTAAAAGATATAATCTATTACGATGCTCCA
GCTAATAAGCACTGCATATTTACTTATGTAAATATAGAAAAAGTTATTAATCATTTCCAT
AAACCTATTTAATAAGATCCTAATATTGTTGGTAGTGAAATGATATTAGGATATCCTCCA
AACGATCAAGATGGCTATAAGTAAATCATTGATAGCTGTGGGATAAATGGTGATTAATTT
GAAGACGATGAATTTAAATCAAATGAGTAAAATATGAGTTTCCCTGATTCTGGAAGTAGC
AAAAGGGCTAATTTAGATATAGAATTTTTAAAACTTAAAGATAATCATCATTTTTATGAT
GAAGGAAAAGATCTTTTTGAATTCCCTATTTAGTCAAATACTATAGTTTACAATTAATTG
TCAGATTATCAATTGGTTACATGTATTGAAGCTCTATCTTACTTTCCTCACATCTTTTTC
AAAATATTTTCAGTCAGATACGATTTAGCTGACATAGGATTTGTTTTTATTAAGCTCTAT
ATTAATGGCGAATGGAGAGATATTATACTTGATGATATTTTTCCTTTTTATGATTCTTAA
TAAGATGTAATTTTTTCAACTACAGTTCTGAAAGAATTGGGATATTTATTTCTTCAGAAA
GCTTTCTGTAAAATCTAGAATTCTTTCTTTGGACACAAGTAAGACACAGAAACGATAAAA
GCCGAGGATTATTTCTAAATGCTTTCTGGTCTTCCGTGCAAGAGCATAACTTGGGAAAAT
GATTTAGATGAAGACTAGAAATTAAATGTAAAAAAATTAGTAGAATGTAGCTCTAAAAGC
TGCAAAGTAGCTTACTTATAAGAGAAATTCAGCCGCAGTAGAGATATAGATATTCCAAAA
AATTATCCTTACATCATTTTAGAAGTTGTAGATTTGGGAGTCTAATAGCAATAATTCTAA
CCAAACCACACTTTAACCAATTTAAATAGTTTGAATGCACCCACAAATGAAAACTTATTT
ATAATATTAAAATCAATTGATTCTAATTTTAGCTTTATTAAAAGAAGATGTGAAGAGAAG
ATTTCTTTCTCTAAACACAATTAAATACTTAAAGATATCATTTAAAGGCATACAATTATT
CCTGATGATTTCATGAATTAATATACAAGTTTAAAGGAAAGTAACAATCCAATTAATAAA
AATAAAATATACGAATTCGAAGAATACTTTAAAAAAATTAAATAATCTGTATTTGCTCTA
GATTTTGAAACTTTTATCGAATGCTTTGGAAGCGTTTATTAATTGATTGGAGTTAACCAA
AACTTTTAGAGCTCAAGCTTTGTATAAGAAAATATTGGAACTTAACTGGTGGAATCGAGA
TATTTCTTTTCATTTAATTTGAACTTACCAGCTAGAATTTTAATAAATGTCGAGCAATAT
TTATAGGGAATTAGCTAACATTTACCTGTCAGAATACTATTAGCTTAAGACAAAATGGGA
GTATATGCATAGAGAACTAAATAATCTCATACAGACGATGGAAATGACTATGTAGCTAGA
AACAAAAAAGATTTTTTAAAAAGACAATTTGTGAAGAAAGTTAAAGCAAAAAAAGAAACA
GATTTAATTAATAGAGAAAAAGCTAGTAAATTAGGAAGAGATAAATCTTTTTCAAAAGAC
TAAGATTTGGTACTCAGCTAATAAAGGAGTTCAAAGAAAGATGAGGATTAGCATAATTCC
CAACATGAATCAAGAATTTACTAAAAAAAGAAGTTCCACAGCCTAAAATATATAATTGGA
AAAGGGCAGTATAAAAAGAAAAATGTCTTTAAAACAGTTGTTTTAGATGAAGGAACTTAT
ATACTAATGGTTCAAGTTGAAGGACCTGACCTTAAGAGTTTACAGGATCTAAAAGAAAAT
GTTAAGGAATTTAATTTAAAATTAGTTGTTAATATATTTGGAGATAATCTTCTGAATATT
TTACAAATCGAGCATCCAGAAAATTTTATGCGCCAGGTTTACGAATCGTGTATCCATAAT
GCAGAAAAGAAATACCTTGAGAATTAGTAAAAGTAGTTAAAAGACTAAGTTCAAGATATT
AGATTCTAAAGATCAGATTTGGGTGACAGAGAAAATGGTAGTGACTAAATTATTATTTGC
TAATTCTACCTTTAATAAGAAGGAACTTACTTATAACTACTTGATAATAGAACAGATAAC
AAAAGTTGGAGACAAAAATTGTACTTTATTACTGAAAACATGAAGATAGTAGATTCAAAT
GATAATAAGGTTGATGTCTATTTAGGTCCACACTAAGATGCACTTATTATTATTTAATAA
GTAAGAGGAGGTGTATATCGCTTAGAAGGTGGAGAGGGTATATGTTTAATAGAAAATATT
CAAAAAAATATAGATTCAGACGATAACGATGAATTAGATGATAATTGA


>TTHERM_00575440(protein)
MEVESKVQSQGKDQRYQNEVSYGKRKYVGQFLNGKRDGKGKEEDKTNHTLYEGNFQDDMY
HGIGTLYQLQTKCYFKGIFEKNQKKAGIEIFPNGDVYEGEYKDDQFHGKGYLRNRDLFYF
IDDGKSSQQVNDQKKVQSTYSYEGTFQNGKKDGFGTERYIKGAVYVGEFRNNQKHGKGKL
QYPDGSYYEGDFVNGVPCGFGVHCAYSVEQIQSIKPIKKGATNNSKANERLQRNIQLKES
LAINSLQDIDSSQQLIQKEDEKENYQMSYFDEKPEFYYEGEFMEGFKHGKGRFYFPDGSY
YYCQWAFNKKVKDIIYYDAPANKHCIFTYVNIEKVINHFHKPIQQDPNIVGSEMILGYPP
NDQDGYKQIIDSCGINGDQFEDDEFKSNEQNMSFPDSGSSKRANLDIEFLKLKDNHHFYD
EGKDLFEFPIQSNTIVYNQLSDYQLVTCIEALSYFPHIFFKIFSVRYDLADIGFVFIKLY
INGEWRDIILDDIFPFYDSQQDVIFSTTVLKELGYLFLQKAFCKIQNSFFGHKQDTETIK
AEDYFQMLSGLPCKSITWENDLDEDQKLNVKKLVECSSKSCKVAYLQEKFSRSRDIDIPK
NYPYIILEVVDLGVQQQQFQPNHTLTNLNSLNAPTNENLFIILKSIDSNFSFIKRRCEEK
ISFSKHNQILKDIIQRHTIIPDDFMNQYTSLKESNNPINKNKIYEFEEYFKKIKQSVFAL
DFETFIECFGSVYQLIGVNQNFQSSSFVQENIGTQLVESRYFFSFNLNLPARILINVEQY
LQGISQHLPVRILLAQDKMGVYAQRTKQSHTDDGNDYVARNKKDFLKRQFVKKVKAKKET
DLINREKASKLGRDKSFSKDQDLVLSQQRSSKKDEDQHNSQHESRIYQKKKFHSLKYIIG
KGQYKKKNVFKTVVLDEGTYILMVQVEGPDLKSLQDLKENVKEFNLKLVVNIFGDNLLNI
LQIEHPENFMRQVYESCIHNAEKKYLENQQKQLKDQVQDIRFQRSDLGDRENGSDQIIIC
QFYLQQEGTYLQLLDNRTDNKSWRQKLYFITENMKIVDSNDNKVDVYLGPHQDALIIIQQ
VRGGVYRLEGGEGICLIENIQKNIDSDDNDELDDN


>TTHERM_00575440(gene)
ATGGAGGTTGAAAGTAAGGTGTAGAGCTAAGGGAAGGATCAAAGATATCAAAATGAAGTT
TCTTATGGAAAAAGAAAGTATGTTGGTTAGTTTTTGAATGGAAAGCGTGACGGAAAAGGC
AAAGAAGAAGATAAAACTAGTAAATTGATAAATCATTAATTTAGTTAAAACATCAACAAA
TTATTAAAATAAATAAAAGACCATACCTTATATGAAGGTAACTTTTAAGATGATATGTAT
CATGGTATAGGTACACTCTATCAACTATAAACAAAGTGCTATTTTAAGGGAATATTTGAA
AAAAATTAGAAGAAAGCAGGCATTGAAATCTTTCCAAACGGTGATGTTTATGAAGGTGAG
TACAAAGATGATTAATTCCATGGTAAAGGATATCTCAGAAATAGAGATTTATTCTATTTT
ATAGATGATGGTAAATCTTCTTAGTAGGTTAACGATTAAAAAAAAGTTTAATCAACATAC
TCTTATGAAGGTAATTAATTCATTTATTTGTGTTTAGTTGATTACTTTAAAATAAATTTG
AGTCATTTATAATTAACTAATTAATTTAATTGAGAATATGAAATACTAATAATATAATTT
TAGGCACCTTTTAGAATGGTAAAAAAGATGGTTTCGGCACTGAAAGGTATATTAAAGGCG
CTGTTTATGTAGGTGAATTTAGAAATAATTAAAAACATGGTAAAGGCAAGCTTTAGTATC
CAGATGGTAGCTATTATGAAGGAGACTTTGTGAATGGTAATTTAACAAATTAGGTTTATT
ATAATAAATAAATTATTTTTTGAGAGAAAAATCAAATGTTGGAAAGATTGATTTCAATAA
TTAGCTAATTAATTCATTATCAAGCTATAAATTAAGAAAAAAGGAGACTATGCATGATAA
TAACTTTTCATTTATTTAATAATTAAATAGGTGTTCCCTGTGGGTTTGGTGTTCATTGTG
CCTACTCAGTAGAATAGATATAAAGCATAAAACCAATTAAAAAAGGAGCCACAAATAATA
GCAAAGCAAATGAAAGGTTATAAAGAAATATTTAATTGAAGGAATCCTTAGCAATTAATA
GTTTGCAAGATATTGATAGCAGCTAACAATTAATCCAAAAGGAAGATGAAAAAGAAAACT
ATTAAATGAGCTATTTTGATGAAAAACCTGAATTTTACTATGAAGGTGAGTTTATGGAAG
GTTTTAAGCATGGTAATATTATTTTTTAATTAGCCAGCAACAATAAATAAATGATTTATA
TTCCTAACTAAATATGAAGGAAAGGGAAGGTTTTATTTTCCAGACGGTTCGTATTATTAT
TGCCAGTGGGCTTTCAATAAAAAAGTAAAAGATATAATCTATTACGATGCTCCAGCTAAT
AAGCACTGCATATTTACTTATGTAAATATAGAAAAAGTTATTAATCATTTCCATAAACCT
ATTTAATAAGATCCTAATATTGTTGGTAGTGAAATGATATTAGGATATCCTCCAAACGAT
CAAGGTTATAAATAAATAAATAAATTAAATACTTTTAAGCATATTATAAAAATATTTTTA
ATGATTAATTTTTAAAAAAATAGATGGCTATAAGTAAATCATTGATAGCTGTGGGATAAA
TGGTGATTAATTTGAAGACGATGAATTTAAATCAAATGAGTAAAATATGAGTTTCCCTGA
TTCTGGAAGTAGCAAAAGGGCTAATTTAGATATAGAATTTTTAAAACTTAAAGATAATCA
TCATTTTTATGATGAAGGAAAAGATCTTTTTGAATTCCCTATTTAGTCAAATACTATAGT
TTACAATTAATTGTCAGATTATCAATTGGTTACATGTATTGAAGCTCTATCTTACTTTCC
TCACATCTTTTTCAAAATATTTTCAGTCAGATACGATTTAGCTGAGTAAATAAATATATT
TTCATATAAAATACATTTTTAATTTGTGTAGAATTTTTCTTGTATCAATTAATTATCTTT
TATAATAAATTAATTAATAGCATAGGATTTGTTTTTATTAAGCTCTATATTAATGGCGAA
TGGAGAGATATTATACTTGATGATATTTTTCCTTTTTATGATTCTTAATAAGATGTAATT
TTTTCAACTACAGTTCTGAAAGAATTGGGATATTTATTTCTTCAGAAAGGTAAAAATAAT
TAAATTTACTAATTGAGTGAATATTTTATTAAATATATTTTGATATGAAAAGCTTTCTGT
AAAATCTAGAATTCTTTCTTTGGACACAAGTAAGACACAGAAACGATAAAAGCCGAGGAT
TATTTCTAAATGCTTTCTGGTCTTCCGTGCAAGAGCATAACTTGGGAAAATGATTTAGAT
GAAGACTAGAAATTAAATGTAAAAAAATTAGTAGAATGTAGCTCTAAAAGCTGCAAAGTA
GCTTACTTATAAGAGAAATTCAGCCGCAGTAGAGATATAGATATTCCAAAAAATTATCCT
TACATCATTTTAGAAGTTGTAGATTTGGGAGTCTAATAGCAATAATTCTAACCAAACCAC
ACTTTAACCAATTTAAATAGTTTGAATGCACCCACAAATGAAAACTTATTTATAATATTA
AAATCAATTGATTCTAATTTTAGCTTTATTAAAAGAAGATGTGAAGAGAAGATTTCTTTC
TCTAAACACAATTAAATACTTAAAGATATCATTTAAAGGCATACAATTATTCCTGATGAT
TTCATGAATTAATATACAAGTTTAAAGGAAAGTAACAATCCAATTAATAAAAATAAAATA
TACGAATTCGAAGAATACTTTAAAAAAATTAAATAATCTGTATTTGCTCTAGGTAAAAAA
TTTTTTTTTTTTGAAAATCCTCTTTAAAAGAGAAATTATTTGAAAGAACAATTTATAATA
TTTTTAATTTAATCTGATAAAAAATTTAAATTATTTCATAATAAATAATAAGATTTTGAA
ACTTTTATCGAATGCTTTGGAAGCGTTTATTAATTGATTGGAGTTAACCAAAACTTTTAG
AGCTCAAGCTTTGTATAAGAAAATATTGGAACTTAACTGGTGGAATCGAGATATTTCTTT
TCATTTAATTTGAACTTACCAGCTAGAATTTTAATAAATGTCGAGCAATATTTATAGGGA
ATTAGCTAACATTTACCTGTCAGAATACTATTAGCTTAAGACAAAATGGGAGTATATGCA
TAGAGAACTAAATAATCTCATACAGACGATGGAAATGACTATGTAGCTAGAAACAAAAAA
GATGTAAAAATTAACATTAACTCTCAGTTAAACATATTTTTTTAGTTTTTAAAAAGACAA
TTTGTGAAGAAAGTTAAAGCAAAAAAAGAAACAGATTTAATTAATAGAGAAAAAGCTAGT
AAATTAGGAAGAGATAAATCTTTTTCAAAAGACTAAGATTTGGTACTCAGCTAATAAAGG
AGTTCAAAGAAGTATTTTTAAATTGCCATTTATTTTAGATTTGATTGAAATATATATTAA
TTTAATAGAGATGAGGATTAGCATAATTCCCAACATGAATCAAGAATTTACTAAAAAAAG
AAGTTCCACAGCCTAAAATATATAATTGGAAAAGGGCAGTATAAAAAGAAAAATGTCTTT
AAAACAGTTGTTTTAGATGAAGGTAATTAACTAATTAAATTATAATTAATATAACTAGAA
AATTTCATTTTTATGAAAATGAATATAAATTTAATAAAAATTGAAACTTTTTGATATTTT
TTATTCGATTTCCATTCATTTTTACGATATAAAAATTTTTATTCTCACAAAATTAGTTAC
ATGTAACTAATTAAAAGAATCTGTGCTAATTTTCTCATATTAGATATTTATATATCTTAC
ATATTAGATTTTTAAAATGTAGAAATTGATAAATATTTAATTTAGCTTTTCCTCATTTAT
CTAAGTAAAATAATATTGATATTTTCGATATTTAGGGTATTTTTATTTTATTTTTAAAAT
ATTGATATCTGCTTATATAATAAAAGCTAAATATCGGACAACTATAGTAAATATAAAGAA
ATATTTATATATCTAAATATGTTAAATAAAATACTAATTTACAAAATTAAAGATTTAATC
TTTTTTATTTAAAAAAAAGGAACTTATATACTAATGGTTCAAGTTGAAGGACCTGACCTT
AAGAGTTTACAGGATCTAAAAGAAAATGTTAAGGAATTTAATTTAAAATTAGTTGTTAAT
ATATTTGGAGATAATCTTCTGAATATTTTACAAATCGAGCATCCAGAAAATTTTATGCGC
CAGGTTTACGAATCGTGTATCCATAATGCAGAAAAGAAATACCTTGAGAATTAGTAAAAG
TAGTTAAAAGACTAAGTTCAAGATATTAGATTCTAAAGATCAGATTTGGGTGACAGAGAA
AATGGTAGTGACTAAATTATTATTTGCTAATTCTACCTTTAATAAGAAGGAACTTACTTA
TAACTACTTGATAATAGAACAGATAACAAAAGTTGGAGACAAAAATTGTACTTTATTACT
GAAAACATGAAGATAGTAGATTCAAATGATAATAAGGCAAAATATTTTTTTTGATAATAT
TTCTTTATCAAATTTTTAAAGATATTATTAAAGTTATTAAGATATTTTATCCAACATAAA
TTCAATATTATACCATACATGCATTTTAATAATTAATAAAATATTGTATAAAATAGGTTG
ATGTCTATTTAGGTCCACACTAAGATGCACTTATTATTATTTAATAAGTAAGAGGAGGTG
TATATCGCTTAGAAGGTGGAGAGGGTATATGTTTAATAGAAAATATTCAAAAAAATATAG
ATTCAGACGATAACGATGAATTAGATGATAATTGA