Identifiers and Description

Gene Model Identifier

TTHERM_00431310

Standard Name

MRNO31 (Membrane Occupation and Recognition Nexus protein other)

Aliases

PreTt26472 | 48.m00235 | 3831.m01574

Description

Protein with predicted MORN domains localized throughout the protein and/or associated with other domains having a predicted function

Genome Browser (Macronucleus)

GBrowse

Genome Browser (Micronucleus)

GBrowse

Gene Ontology Annotations

No Data fetched for Gene Ontology Annotations

Domains

No Data fetched for Domains

Gene Expression Profile

  • Tetrahymena Functional Genomics Database:

TetraMine Data

TTHERM_00431310

WebApollo

Fullscreen View

Tetrahymena Stock Center

No Data fetched for StockID

Homologs (v.2006 protein sequences)

SourceIdentifierScoreDescription
Tetrahymena borealisEI9_04161.18.999968595758151e-173hypothetical protein (555 aa)
OxytrichaContig20231.0.g380.00000000000059990805086298MORN repeat
DictyBaseDDB_G03494880.000004000864880866421DDB_G0349488 on chromosome: 2
position 6912714 to 6914186

General Information

No Data fetched for General Information

Associated Literature

No Data fetched for Associated Literature

Sequences

>TTHERM_00431310(coding)
ATGTTAAATCCTGCAACTCAATCAAACCACATAAAAACAAGTAGCGATATTCTTTAGGAA
TTTAATTAGAAGCACTATGGAAGCTAAGAATTTAGACCATCAGTAGTTCAAATCAACCAC
TAAACTAAAAGTGCAGTGACACATAGTAATCACAATTTAAGTAATCATGATGCAATAAAT
TAATCAAACTAGTATTTTACTCCTTAGCCTTCCTCTCAAATTCAATAACAAAACAATATA
GCAAAAAGCAATGTCTATAATGATACTTACTAAAGCAATAACGGTATTCAACAAAGCAAT
TACAAAGCTTACGTTTAGGATAATTAGTCAAAGATTCAAAAACCCAATCAATTGCAACAA
TAATAAGCTCAATAATTTAGCTAAAATAACTAAGTTTCTAACAACATATTCCTTAGTGGC
ATATAACAAAACTAAAATCCTCCACGCAGTGATAATTTATATTCAATTAGCAGTAGAATT
GAAGAACATTAAAGATTATCTTAGAAAAAAGCTAGCAACAAATTGTATGATTCGTTTATT
GGAAAAGAAAAAGACTTAGAATCTTCATTCACAAACGGCAACGAAAATAGTAAGAAAGCT
AATTAGTTCAATGATAATTTAGGAAAAGATTTTAAGCAGATGACTTCAAGAGAAATTGGA
TAAAGTTTGTTACAATAAGAATAAAAAAGATACTTTAGTCCTGCCTCTCCTGAGTAGTTG
TAAAATATAATTACTTTAAAGAGAAATAGAGGAGTCTACAAAGGACAAGTTAAGTAAATT
AAAGGCGAAAATGTTTTAGAAGGTATTGGCCAAATGGAAATGTTTAACGGAGATATATAT
ATGGGCTATTTCTGGAGAAACTATATGCATGGTGATGGCTACCTCTTAAAACAAAATGGT
GATTTCTATAACGGAAAATTCTAGAACGATAAAATCCAAGGATTTGGTAGATATTATTAT
ATTAATGGTGATCTCTATGAAGGAAATTTCTATTATGGTGTAAGACAATCAGAAAATGCA
AAATTCTACTCAGCAGCTGAAGATGCCTGGTATGAAATCCCTTTCGATCAAGATAGAAAG
CATGGAAAAGGATAAAGAAAAGATAATTAAGGCGTCGTTTTAAACGTTGAATTCTTTTAA
GATGTGCTATAAACTGGTGACAATGTGAATATAAGTCAAGTAAACTTGAATGATTATTTT
GTAAGTAAAATCAAAGAAGAAGTTTTGTATGAAAATTAACCAGTAAAAGAAGAAGTAGTT
AAACGCACAAAGAAAGAATAAAAGCCCAAAGATATTCACTATTAAGCTATGCAAGAATTA
GAAGGATTCATTAAAGAGGGATTGCCAATCTATTCATTTGAGCAATAACTCTCGAATCCT
ATTTAAGGCTAAGCAATTTACAAATTTTAAGATGGCTCTTATTACGCAGGAAATTGGTTA
AATGGTGTCTTCCACGGATTTGGTCATTACTATGATTCAAAAGTTGGTTTGTATAAAGGT
GATTTTATTTAAGGATTAAAGAATGGCTTTGCTGATATGTTTTACTTCAATGGTGATGAA
TATCATGGAATGTGGGTGCAAGATTTAAAGCATGATGAAAAGGCATAATATTTTAAATTT
AGTAAACAACAAGCATATGAAGCATATTTTAGCCAAGGAAACTTGATTAAGATAATAAAA
CCTGTCTAATAGCAATTATTCTGA


>TTHERM_00431310(protein)
MLNPATQSNHIKTSSDILQEFNQKHYGSQEFRPSVVQINHQTKSAVTHSNHNLSNHDAIN
QSNQYFTPQPSSQIQQQNNIAKSNVYNDTYQSNNGIQQSNYKAYVQDNQSKIQKPNQLQQ
QQAQQFSQNNQVSNNIFLSGIQQNQNPPRSDNLYSISSRIEEHQRLSQKKASNKLYDSFI
GKEKDLESSFTNGNENSKKANQFNDNLGKDFKQMTSREIGQSLLQQEQKRYFSPASPEQL
QNIITLKRNRGVYKGQVKQIKGENVLEGIGQMEMFNGDIYMGYFWRNYMHGDGYLLKQNG
DFYNGKFQNDKIQGFGRYYYINGDLYEGNFYYGVRQSENAKFYSAAEDAWYEIPFDQDRK
HGKGQRKDNQGVVLNVEFFQDVLQTGDNVNISQVNLNDYFVSKIKEEVLYENQPVKEEVV
KRTKKEQKPKDIHYQAMQELEGFIKEGLPIYSFEQQLSNPIQGQAIYKFQDGSYYAGNWL
NGVFHGFGHYYDSKVGLYKGDFIQGLKNGFADMFYFNGDEYHGMWVQDLKHDEKAQYFKF
SKQQAYEAYFSQGNLIKIIKPVQQQLF


>TTHERM_00431310(gene)
ATAATAAAAATTAAAAAAAGAGAAAAAAGAAGAAATATTTATCACAAAATTTGGCAAACA
TTATTAATTAATTAAATCATTCATTCATTGATTAATTTATATCATTTGAATAAGATTTTT
ATTTAGCAAATCACTCATTAAAAAAAAAATATTTATATATTAATAAAAATTTAGCTATCA
ATAATGTTAAATCCTGCAACTCAATCAAACCACATAAAAACAAGTAGCGATATTCTTTAG
GAATTTAATTAGAAGCACTATGGAAGCTAAGAATTTAGACCATCAGTAGTTCAAATCAAC
CACTAAACTAAAAGTGCAGTGACACATAGTAATCACAATTTAAGTAATCATGATGCAATA
AATTAATCAAACTAGTATTTTACTCCTTAGCCTTCCTCTCAAATTCAATAACAAAACAAT
ATAGCAAAAAGCAATGTCTATAATGATACTTACTAAAGCAATAACGGTATTCAACAAAGC
AATTACAAAGCTTACGTTTAGGATAATTAGTCAAAGATTCAAAAACCCAATCAATTGCAA
CAATAATAAGCTCAATAATTTAGCTAAAATAACTAAGTTTCTAACAACATATTCCTTAGT
GGCATATAACAAAACTAAAATCCTCCACGCAGTGATAATTTATATTCAATTAGCAGTAGA
ATTGAAGAACATTAAAGATTATCTTAGAAAAAAGCTAGCAACAAATTGTATGATTCGTTT
ATTGGAAAAGAAAAAGACTTAGAATCTTCATTCACAAACGGCAACGAAAATAGTAAGAAA
GCTAATTAGTTCAATGATAATTTAGGAAAAGATTTTAAGCAGATGACTTCAAGAGAAATT
GGATAAAGTTTGTTACAATAAGAATAAAAAAGATACTTTAGTCCTGCCTCTCCTGAGTAG
TTGTAAAATATAATTACTTTAAAGAGAAATAGAGGAGTCTACAAAGGACAAGTTAAGTAA
ATTAAAGGCGAAAATGTTTTAGAAGGTATTGGCCAAATGGAAATGTTTAACGGAGATATA
TATATGGGCTATTTCTGGAGAAACTATATGCATGGTGATGGCTACCTCTTAAAACAAAAT
GGTGATTTCTATAACGGAAAATTCTAGAACGATAAAATCCAAGGATTTGGTAGATATTAT
TATATTAATGGTGATCTCTATGAAGGAAATTTCTATTATGGTGTAAGACAATCAGAAAAT
GCAAAATTCTACTCAGCAGCTGAAGATGCCTGGTATGAAATCCCTTTCGATCAAGATAGA
AAGCATGGAAAAGGATAAAGAAAAGATAATTAAGGCGTCGTTTTAAACGTTGAATTCTTT
TAAGATGTGCTATAAACTGGTGACAATGTGAATGTAATAAATAAATAAATATTTTTATTT
GAAAAAAAAGCTATTTTTATTTACGTTATTTAACTATAAATAAATTAAAGATAAGTCAAG
TAAACTTGAATGATTATTTTGTAAGTAAAATCAAAGAAGAAGTTTTGTAAGAAAATAAAT
TTATTAATTTATTAGTTTGAGTTAGTTAATTCATGATATTCAATTAATAGGTATGAAAAT
TAACCAGTAAAAGAAGAAGTAGTTAAACGCACAAAGAAAGAATAAAAGCCCAAAGATATT
CACTATTAAGCTATGCAAGAATTAGAAGGATTCATTAAAGAGGGATTGCCAATCTATTCA
TTTGAGCAATAACTCTCGAATCCTATTTAAGGCTAAGCAATTTACAAGTAACCTATTACA
AGATTAGCAATTTTCATTAACTCAATCAATCTCTATTTTAAAATAGATTTTAAGATGGCT
CTTATTACGCAGGAAATTGGTTAAATGGTGTCTTCCACGGATTTGGTCATTACTATGATT
CAAAAGTTGGTTTGTATAAAGGTGATTTTATTTAAGGATTAAAGAATGGCTTTGCTGATA
TGTTTTACTTCAATGGTGATGAATATCATGGAATGTGGGTGCAAGATTTAAAGCATGATG
AAAAGGCATAATATTTTAAATTTAGTAAACAACAAGCATATGAAGCATATTTTAGCCAAG
GAAACTTGATTAAGATAATAAAACCTGTCTAATAGCAATTATTCTGA