Identifiers and Description

Gene Model Identifier

TTHERM_00102750

Standard Name

MRNO30 (Membrane Occupation and Recognition Nexus protein other)

Aliases

PreTt22975 | 7.m00424

Description

Protein with predicted MORN domains localized throughout the protein and/or associated with other domains having a predicted function

Genome Browser (Macronucleus)

GBrowse

Genome Browser (Micronucleus)

GBrowse

Gene Ontology Annotations

No Data fetched for Gene Ontology Annotations

Domains

  • ( PF02493 ) MORN repeat
  • ( PF05316 ) Mitochondrial ribosomal protein (VAR1)

Gene Expression Profile

  • Tetrahymena Functional Genomics Database:

Change in Gene Expression

TMHMM

TMHMM

Signal Peptide

Signal Peptide Present?: No
Presense Probability: 10.3%

TetraMine Data

TTHERM_00102750

WebApollo

Fullscreen View

Tetrahymena Stock Center

No Data fetched for StockID

Homologs (v.2006 protein sequences)

SourceIdentifierScoreDescription
Tetrahymena borealisEI9_00328.16.001495391698771e-147hypothetical protein (569 aa)
OxytrichaContig6011.0.g864.0013320766793207e-25MORN repeat
Stentor CoeruleusSteCoe_278630.000000000005109089028063325
DictyBaseDDB_G03494880.00000019998969434520019DDB_G0349488 on chromosome: 2
position 6912714 to 6914186
SGDYOR233W0.0004999512321494991KIN4 Serine/threonine protein
kinase that inhibits the mitot
ic exit network (MEN) when the
spindle position checkpoint i
s activated; localized asymmet
rically to mother cell cortex,
spindle pole body and bud nec
k

General Information

No Data fetched for General Information

Associated Literature

No Data fetched for Associated Literature

Sequences

>TTHERM_00102750(coding)
ATGTTTGATTCAAAGTAAAATATTACAAATTATTTGGAAAAAAATGGTTTTAATAAGATT
CAATTCTAAGCAAATCAACAAGATTAATATTCAAAAGATACTAAGAATTTAATCCAAGCT
TGGAATAGTTAAAAAAAATAATAAGCATTTATCAAGGTAATAGAGGTTAGAAATCCACAA
TAAACAATAGATCGAATTAAAATGGTTTAAAATTTTGAAACAAAGTTTATTCAAAAATAT
GATAAACCACCAGAAATAATTGATAATGGATTGATAGTATATTCAAATAGCTTTCAAAAA
AATGGAAATTTAAAAAATTATTAGTAAAAAAAGCAATTAAATATAGATATAGTTTAAAGA
TTAGCCTGTAAAATACTTATAGGATTAGATTGCTTACATAAAAATAAACTTTTTCATGGA
AGATTTAAAATTGAAAATGTTCTTATGGATTAAAATGAATCTATTTTGCTTACGGATTAT
TGTATACAAGATAGTGATGATTTTTTCTTGGAAAAAGAATAAAATCATTTTAATCAAGAA
AAAAATATTTTTGAAAATTTGAATGTTTCTATTGAAGAGATGCAGAGCTAAGATTTGTAC
AGGGCAGGAGTTTTAATAATTAGCCTATGCGATTTGTTAAGAGAAAAAGAATAAAATTTA
GATCAATAACTAAGATACAACACGAAAAGATCTTATTATTTGTAATAAATAGCCAACAAT
CTTGTTGACTAGGATAATCTCAGACTTTTTAATTTATAATTTACTTTAGAAAAATTAGAT
TATTTTGAAGGAATCTATTAATCTTTTTTGTTTGGTTTAAATACTTATGAAGGAGAGATG
TAAAATAATAAAAAACATGGAAAAGGTGTTTTCAAATATTTTATTGGTGATTTGGTATTT
GGAGTTTGGGAGAATGATAAATATACTGGGAATGGAGTAACTTATTATTAAAATGGTGAC
ATTTCAGATAAGAGAGATAATAATTATATTATGTATTGGAAAAAATCATAATGTATGATC
GAAGGAGTATATTCAAATGATCAAAAAGCTATCTAAGGAACCTACTTCATTGATGGTAGC
TAATGGAAAGTAACTTATATAAATAAAAAATTCTAAGGCTATTCAGAAATTTATTATAAA
AATAATGAGAACTTATTTAAAGGAAATTTAAAGGATAGTTAATAGCATGGCTATGGTGAA
TTATTTTGGAAGGTAAATCAAGTATTCAAAGGAAAATTCTAAAATAATCAAATTGATGGT
TTAGGGCAATTTAAACTCTAAGAAGGAAGTGAATATTTTGGATAGATGAAATACAATAAG
TTTCATGGTTATGGAAAATTATACTGGAATATAGGTAGTTATTATGAAGGATAATGGGTT
AATCACCAAAGATAAGGATATGGAAAATATTATGACTATTTTAGTGGTTCTATTTACGAA
GGTATGTTTTAAACAAGCTAATAAGATGGTGAAGGTATCCTTAAATAATAAAATGGTACC
ATAAAATATGGATTGTGGTAAAAAGGTATTTATGTTTAAGGATCTGACAAGCAAGTTGAT
TTAGAGTAGCTTAAGTAAAAATTTTTAAATTTAAGTCTTTCTTTACAAAAAAGTATGCGT
TGA


>TTHERM_00102750(protein)
MFDSKQNITNYLEKNGFNKIQFQANQQDQYSKDTKNLIQAWNSQKKQQAFIKVIEVRNPQ
QTIDRIKMVQNFETKFIQKYDKPPEIIDNGLIVYSNSFQKNGNLKNYQQKKQLNIDIVQR
LACKILIGLDCLHKNKLFHGRFKIENVLMDQNESILLTDYCIQDSDDFFLEKEQNHFNQE
KNIFENLNVSIEEMQSQDLYRAGVLIISLCDLLREKEQNLDQQLRYNTKRSYYLQQIANN
LVDQDNLRLFNLQFTLEKLDYFEGIYQSFLFGLNTYEGEMQNNKKHGKGVFKYFIGDLVF
GVWENDKYTGNGVTYYQNGDISDKRDNNYIMYWKKSQCMIEGVYSNDQKAIQGTYFIDGS
QWKVTYINKKFQGYSEIYYKNNENLFKGNLKDSQQHGYGELFWKVNQVFKGKFQNNQIDG
LGQFKLQEGSEYFGQMKYNKFHGYGKLYWNIGSYYEGQWVNHQRQGYGKYYDYFSGSIYE
GMFQTSQQDGEGILKQQNGTIKYGLWQKGIYVQGSDKQVDLEQLKQKFLNLSLSLQKSMR


>TTHERM_00102750(gene)
ATGTTTGATTCAAAGTAAAATATTACAAATTATTTGGAAAAAAATGGTTTTAATAAGATT
CAATTCTAAGCAAATCAACAAGATTAATATTCAAAAGATACTAAGAATTTAATCCAAGCT
TGGAATAGTTAAAAAAAATAATAAGCATTTATCAAGGTAATAGAGGTTAGAAATCCACAA
TAAACAATAGATCGAATTAAAATGGTTTAAAATTTTGAAACAAAGTTTATTCAAAAATAT
GATAAACCACCAGAAATAATTGATAATGGATTGATAGTATATTCAAATAGCTTTCAAAAA
AATGGAAATTTAAAAAATTATTAGTAAAAAAAGCAATTAAATATAGATATAGTTTAAAGA
TTAGCCTGTAAAATACTTATAGGATTAGATTGCTTACATAAAAATAAACTTTTTCATGGA
AGATTTAAAATTGAAAATGTTCTTATGGATTAAAATGAATCTATTTTGCTTACGGATTAT
TGTATACAAGATAGTGATGATTTTTTCTTGGAAAAAGAATAAAATCATTTTAATCAAGAA
AAAAATATTTTTGAAAATTTGAATGTTTCTATTGAAGAGATGCAGAGCTAAGATTTGTAC
AGGGCAGGAGTTTTAATAATTAGCCTATGCGATTTGTTAAGAGAAAAAGAATAAAATTTA
GATCAATAACTAAGATACAACACGAAAAGATCTTATTATTTGTAATAAATAGCCAACAAT
CTTGTTGACTAGGATAATCTCAGACTTTTTAATTTATAATTTACTTTAGAAAAATTAGAT
TATTTTGAAGGAATCTATTAATCTTTTTTGTTTGGTTTAAATACTTATGAAGGAGAGATG
TAAAATAATAAAAAACATGGAAAAGGTGTTTTCAAATATTTTATTGGTGATTTGGTATTT
GGAGTTTGGGAGAATGATAAATATACTGGGAATGGAGTAACTTATTATTAAAATGGTGAC
ATTTCAGATAAGAGAGATAATAATTATATTATGTATTGGAAAAAATCATAATGTATGATC
GAAGGAGTATATTCAAATGATCAAAAAGCTATCTAAGGAACCTACTTCATTGATGGTAGC
TAATGGAAAGTAACTTATATAAATAAAAAATTCTAAGGCTATTCAGAAATTTATTATAAA
AATAATGAGAACTTATTTAAAGGAAATTTAAAGGATAGTTAATAGCATGGCTATGGTGAA
TTATTTTGGAAGGTAAATCAAGTATTCAAAGGAAAATTCTAAAATAATCAAATTGATGGT
TTAGGGCAATTTAAACTCTAAGAAGGAAGTGAATATTTTGGATAGATGAAATACAATAAG
TTTCATGGTTATGGAAAATTATACTGGAATATAGGTAGTTATTATGAAGGATAATGGGTT
AATCACCAAAGATAAGGATATGGAAAATATTATGACTATTTTAGTGGTTCTATTTACGAA
GGTATGTTTTAAACAAGCTAATAAGATGGTGAAGGTATCCTTAAATAATAAAATGGTACC
ATAAAATATGGATTGTGGTAAAAAGGTATTTATGTTTAAGGATCTGACAAGCAAGTTGAT
TTAGAGTAGCTTAAGTAAAAATTTTTAAATTTAAGTCTTTCTTTACAAAAAAGTATGCGT
TGA