Identifiers and Description

Gene Model Identifier

TTHERM_00947580

Standard Name

MRNO28 (Membrane Occupation and Recognition Nexus protein other)

Aliases

PreTt19678 | 174.m00062 | 3678.m00027

Description

Protein with predicted MORN domains localized throughout the protein and/or associated with other domains having a predicted function

Genome Browser (Macronucleus)

GBrowse

Genome Browser (Micronucleus)

GBrowse

Gene Ontology Annotations

Molecular Function

Biological Process

Domains

  • ( PF02493 ) MORN repeat
  • ( TIGR01612 ) rhoptry protein
  • ( PF00069 ) protein kinase domain
  • ( PF07714 ) protein tyrosine kinase
  • ( PF02212 ) Dynamin GTPase effector domain
  • ( TIGR00864 ) polycystin cation channel protein
  • ( TIGR01442 ) small, acid-soluble spore protein, gamma-type

Gene Expression Profile

  • Tetrahymena Functional Genomics Database:

Change in Gene Expression

TMHMM

TMHMM

Signal Peptide

Signal Peptide Present?: No
Presense Probability: 9.9%

TetraMine Data

TTHERM_00947580

WebApollo

Fullscreen View

Tetrahymena Stock Center

No Data fetched for StockID

Homologs (v.2006 protein sequences)

SourceIdentifierScoreDescription
Tetrahymena borealisEI9_19821.19.997093137033517e-262hypothetical protein (2161 aa)
OxytrichaContig1235.0.g953.999970367130025e-21MORN repeat
Stentor CoeruleusSteCoe_175030.0000000001026187963170189

General Information

No Data fetched for General Information

Associated Literature

No Data fetched for Associated Literature

Sequences

>TTHERM_00947580(coding)
ATGGGATAAATATTGAATAAGCAAAAATAGAAGTAGGCTGATGGACCTACAAAAAATATA
GAAATAAAATCCAAACTTGAAGTTATTTAGGATTTAAAGCATTTAGACTAGACGAAAAAT
TTAATAGATGTCTTCCCTAAATACGAATAAGTATATAAATTCTTAGAAAAGAAAGAACAC
AGAATATATGGAGAAATATTCATATTGGCAGAAACCAACGATCCAAATATTCAAATAGCC
GTTTAAGAAAGTTTTTTCTAAAACTAGTTTGAGTTTTAAATGGAAGTAGAAAATTTAAAA
GAAATAGAAAGCTTCACTTAATAGCATTAAAATTTAATTTAACTTATTAAATACTTTGAT
TATAATTACAATTCTATGTGCACTTCTTTTCATAGGCTTATAACTGTAACAGAATATCTT
TCAAGAGACCTTTCAACAGAATTATTCTTTAGGAAATTATTAATTGAAAAAACAACATCA
AGCGCTACCCCTAAAAATGGGGAAAGTACAACTAAATCTAATTAAATGTAAGTAAGCTTG
TCTTCAAAAAGCTAAAGAAGTCTTTCTGCAAACAGCGTTGCAGTTCAGAATTAATCTTAA
GTGAAAAATAACAGCAACATGTTACATTCAAAAAGACTTTCAGAAATCTAAAGAAAAAGT
GTACTCATTGTAACAAAAGTATTTTCCACTCATGAAAATGACAACATTATAGAAGATCAA
GGAGAAGATGAAGGCAACTTTTATGAAAAAAGAGGAGCAATAGCAAAATAGATAAAAAAT
AGGAGCCACTTTTAATTTAATGCATCGGATAATGCTTACAGATTTTAGGAAAAAGAATTT
ACTTACATATTAAAATCCCTTATATCAGGATTGTGTTACCTATAAATGTAGAATAGAACT
CATCAATGTCTTCGCTCATCATCCATTTTCATAGCTCGAGACGGTACTATCAAGCTCACA
GACCCTCATTTGTTTAATCAATCTTCTCTCTACACATACATTTACAAAGGGCAATCAGTC
AGTGGAGCATATTTATCACCTTTGCTAGTTAGTAATGTAGAATATTCAGTAGTAAAGCCT
GAGCATAACGAATACAAAAGCGATGTTTTCACATTGGCTGTGATAATGTTAGAAATAGCT
TATTTAAATAAGTTAGATAACTACTTCGACTACACTGAATACTGTTTAGTTGATGTTGAA
GGTTTGTAGATTCTAGCAGAAAATTTAAAAGATATATACTCACAATCTATAATATCTCTT
TTACTTTAAATGCTTGATGAAAATGAAGATATCAGACCAGATTTTGTCTCCTTAGCTTAA
AAGTTAGGAATATTTAATGCTAGTACTAATGCAGTTGTTTAGCTTTCCAAAAATGATTCA
TAGAGCGTAATTTATTCTAAATTAGCGTCATCCACATCTTCAAACCAAAAACCAATACCT
TAAGCAACATCAATTATTATATAACCTTCAGATTAATCATTTACATCTTAATCACCTAGA
TTTTCTAAGACTAATGAATCAAATCAATAGCAATCGATATAGAATGCAACACCAAAAATA
ACATAAATCTCTGATGCTAAGTAAAAATAAAATAATTTTACTCAAATTTTAAACCCATAC
ACTTAAGACACAGTTAGGAAGAGTAAAGAATTATAAATAACCGAAAAAAATTCTAAACTG
TAAAACTAAGCTAATTCAAGATCACTAACTCCAAATAGAGAAAAAACTCCAAATAATGTT
CCTTTGATACCAATAACGAATTCTTCATAAGATGCTTAAACTAGTTCTCCATAAATTGCA
ACAAAATCTGAAAAACATGAATCAATATGTAATGATATGTTAACTCCAAAGAGACCTTAA
CTAGCTGAGAATTTAGACAATAATTACAGATTTATGACTCCTTTACCTTAAGTAAGACTG
TAAACTCCTGATAACACTACAATATAGAAACATATGCACTTACTGAATCAAACGCCTTTG
ACAAAAACTAAGCAATAACCATTTTTTAACAAAGGAGTTTCTCCAATAAAAACAGAAAGT
ACTGCATCAGACATTCAAAGAACCTTGAAAACTGAAAGCTCAATTGATCCATAAAGATAT
CATGCAAGATCTACTTCTCCAATTATGCATCATTAGTCTAGCCCTTCGAAATAACCAATT
ACACCGAAATCAGATTTCAATAAAATAATAAGTAGCCAATATACTCCTACATAAGTAAGA
ATGAGCATAAATCAATCTAATCATTCATCTTATCCTTTAAATACAAGTCCTTTTTATTAG
TAAAGCTATTCTCCAATCAGTTCATACTAAACAGAAAAATCACCAATTAGTACAAACAAT
AACAACAACAACTAAAACTTATCTCCAATAAGCAACTATTCTACATAATAACAAAACAAA
ATCAAAGAAACATAAAACACTTTGACCAATTCTAAAGCTTAGAGCAGAAAAAATTCAAAT
TCAAACTAAATATAATCATAGAATTCATATCAACCTTTGAGTAAATAGCAGAGTACAGTT
TCTCCCATCAATACAAAATAAGAAACAAAGCCAACATTATCAAGATAGTCTTTATCTGCA
ATTAATATTTAGCAAGTTGGTAATTTGAGTAATAATAGAAACAGTATAAGTGATTCATCT
AAGGCATTTAATTTAGTAAACAGTTCAAGATCACCTTCTCCCATAACAAGTAAAAGTACT
CAACAAATAAAAAAAATGATTAATTAAAGTGAAGAAAAACCCTCATCTGCAAGTATTTAA
ATACAATAACATATTCAGAATAAAAAAAATGAGTAAAAAAATAGCTAACAAAGTCTATAA
TTATCTAACAATTAATCAACAAATTCAAACAACTAAATTGCATTAAAAAAATTGTCTATT
TCTAACCCTTAAAGTATATTACCAACAAAATATTAATCTTAGAGTTCAACAGTTGAAAAG
GATATTATATCCTTTAGCAGATAACCTACTTTTGCTCCTTCTTAAATTGGGTAATAATAG
AAACCTCCATCATTAAAATCTTCATTGCAATAAAATAAACAATCTCTATAAAATCTAAAC
GTCTTTACACCCCAAAGCTAAATTTCAAATGGTGTAAATGTTTAAGCATATCTCTCATCT
TAATCTACTGTTAATAGATATAGCTATGGTAATATATAGATTATAAACTAGTTTGATAAT
AAATCTCCTGCTCTTACTAAATTATCCAACCTTTCTGCAGCTAACAATTTAAATGGTAAT
AACTAAACTTAACATGAACCTCAAAGCCAAAAAAATTATACAGGAGTTGCTTAAAAAAAA
GGTTCTGTTTTAAGAATAAATTAAAACGTAAAATCTTAAAAGCATGGTAGTTTATAAATT
AATGAATAACAAACATTTGGATAGTAATCCATTCAGAGTTCAGTTAACAATAATAGCTAA
ACAGACTCAATGACTGAATCTTCATAGTAGATGAAAAGCTCCTCTCGATAATCTCAAAAA
TCTCATAGATAAAGCTAATCAGGGAACTAATTTTAGTACAGAAGTAAAACAGAAATAGGG
AATGAATAAGATGTAATAACTTAAGATAATTAAAAATTCTACGATAACTTTTTTAAAAGC
GATAAATCTCCAGTAATTTAATCAAATCTTTAGCTTTTAAATTTAAAGTAGCAACAATAA
AAGCCTTAGTAAGAGACTATATACAAACCATACATCCCTAAAATGTGCATAAATACTAAT
AATGATTAATAAGCTTTCAGCTCTTAAAATTTCAATAATTCCAAGTAATAAAATGGGGGA
AAACTAATTGAAGGGCTAGGAGATCTAAAACCTGCAAGCGAGTTATTTTCGAATAACAAG
AACAAAGATTAACCAAAATCAAAAGCATAAATAGAAGAAAGTCAATAAAAATCTCTTAAA
TAGTCTGTATCTTCAAATTTAAGTTAATCTTCAGCAAATAAAATCCAAAAAAGAAATTCA
AATCAAATTGATATTAATGCAAATGAGGTTTCTAACAAAAATATCAAAAATGAACTCACT
ATGAGTTAAATTAACAGGGAATTAGAAAAACATAGGAATTTTTCTAAAAAGCTTTAAGAA
GAAATGGAAAGATAAAAGCAATAACAGTAAATATTATAATAGCAAATTGTTAATTCTTCA
TCAAAAATTACTGAAGATTAAAATAATTTAATACCTACATTAGAAAAATAGAAATCTATC
AACACAATTATAGACTAGCACATATTTGACAATCAACTTAGATAAACTCCCTCTGATATT
GTTTTTCCTTTTTCCAATCAAAATTATTCTTCAACAAATGATCAGCCCTTTAAATCATAT
AACCACACAGGCACTTTTGGGAAATAACCCTCAAGTGATAATTAAAATCAAGAATAAATT
TAAAATGATATATTATAAAATGGATAAGCTGAAGACAAGGAAGAAGAAGAAAAACCTAAG
AAGACTTCACCTCCTAAGGAGTTTGGTACAGATTACATTGATTAATTGATAGCTAAATTT
AAATCTGAAATCACAAGTTAAATATAAACAAGCAATAACCAACCAAATAAATAATCATCT
GATGCTGCAGAAATAACTCAACCAAACAATACAAACTTGTCAAAAAACACAAACTCTATT
ATTCCAAGCTATACTAGCTACTATGCTACAAAAACAGACCTAAATAATCAACCACAATCG
TAAAATGAGTATTAAAATGTTTCTCCAAGCAATATAAATTAGAATGATTAGTAAAATAAA
ACTAATTTAAATATTGCATCGAACAACAACTTGACTGGTGAAAAATATGCAGATTAGCCA
GCTAGTTCTGAAAGAATTATGAAGAGAGTAGAAAGTGACAGTATAGGAATAGGCTTTGCA
GGATTTAATGCAAAAGCTTAAATTTAGCTTTAAAAGAAGGGAAGTCTAAATAATTTTTAA
GATGAAAAAATAGCTTCTAACGATTTCCCCGTTGTAGGAAGTAGGGCAGATCTACCAAAA
AGCCCAAACAGCTACATTAAATAAAACTTTACAGAAATTCACTCTATACCTCTTTCTCAG
CTGTAGAAGGCTGAAGCTTTACAAGGACTAGATTGTTAAGAATTAAAGGGGTAACTTAGC
TAGTAACTTAAAGCTAAAAAAAGATATTCAATAAATGAGAAATATCAAAATGAGAAGGAA
AAAATAAATTTAGAAACTTAGCAAGATAGTAGTATTTCTTCGAATGTATAAGAGGCAAGT
TCTGTTTATAAAGGAAATAGTAAATAAAATTATGAAAATATGGCTGGTTATAAAGATAGC
ATAGAGTAAATTTCATAAAATACTTCTGTCTCAAATAATAGTTAGTCAATTCAAATCGTA
CTTCCAAAGTAGACAAATTTATTTGGAGAAAAATAGCAAAATTAAACTTAAGTAAACAAT
GGTACAGATTCATATGGGAATTTTGTTAATAATTAAATTTTACACACTGATAAAAGTGGA
AATGATTTGTAGAGAGCACTTAATGAAAAGAAATAAGAAGGAGATTAAAATAATATTTAG
ATGTAAATTTATAAACAAAACACATTTGGTACTAATGCACCTGCACTTATGGATGCAATA
AAGAAAGGCAACTACGTTACAGAAGATTTAAGTTAACAATATTAGAGTGCATAGTTTAAT
AATTTTAATAGCTAGAACGGTATAAATCCTCCTTTCATTAGCTTTGCTTAAATAAGCTAG
CAAAGTAATTTAAATAGCATTGAAAATATTATTAGTACTAACTATTAAAGCGAAATTAAA
TTTGATCATTTGAATGGTTATGGTGATGCTTAATATAAGCTAGCTAATAAATTTAATTAA
AATATAGGAGAGTAATTGAAGAGTAATAACAAATAAACTTATGAAGAAGATAGAAGTGAA
ACAAATAACATTCTCATAATTAACAACAATGATAGTTAAAGAGAGGATTATGTAAACAAT
TAGTTCTGTCATTTGCAAAGAGAAGCTGTAATTGAATATAAAACACCTAAAACAAAGTAA
TCTTCAGAATAGGTTCTTACTCCAACTTCAGACGATGCAATTAAAAATTTCTTAGACAGG
GTAGAAAAAAATAATGCTTATCAAATTCCCAATGATTTCTTATCAAACTATGTTTAAAAT
AATTAAATAAACATTAATAATACTTAAAATGAATAGAACATGTATGCAGTAATCTCTGAA
GGGGAAAATATAAATTCTAAACTATTAGACATTAAAACACCACTTAACACTAACTAATAC
TTCAATAATGGAAACTTTAGTGGAGGTGGTAGTAGCAGCATTTACAAGTTAACAATAACA
CCACCTCAAAAAGATTAGCTCGAAACTCCTCCCACAAACACAAATATTCAGGTATATGAA
TTTGAGAATGAAAACGTTGCTGCTTTCTCAGATGAACATTAATTTTAATACTAAAATTAG
CAATATTATAATAATGTGATGGATGGGTGTTAAAATATTAGCAACATTTAAAAAATAAAC
GAAGATGAGACATATAATTCGAAGAGAAGCTTTGACGCTTCTGCTGATTTACTAATGATG
CGTAGTAACTAAGACATATAAGAAGGAATTGAAACCAGTAATTTTAATTACCAAGCTAAT
ATGATGGCTAACCCAAATTTTTTGAACAGTCCTAAAAAGACTAATCGTAATTAAGTTTAA
AGTAATAATTAAAACTAAAACCAGTACAATATTCAATAATCAGACAGAAACAACAACAGC
AAAAATAATTAAATCAATTAATAGAATTATACCAGTAATTCTAATTTAAGTCCAAACAAA
AACTATTTATTCACTCCTTCTCCCACTAGAAAAGATGATAGCGCACAATTCAATCAAACG
TTTAGTGATATTCAGATGATATAGTTTTTGAAAAACAAAGAAAACGTTATAGAGACTTAT
GAAGATGGGTCATATTACGAGGGTGAAAAAATGAATGGAGTCCGTCATGGAAGAGGAAAA
TTCTTTTATGGAGATGGAGGCTCATTTTAAGGCGAATGGTAAAATGGACACATGAATGGG
TATGGAGTGCTTTATTATCCTTCTTAAAATAAAGCTTATGAAGGAGAATGGGATGATGAT
AAATTTAATGGTAAAGGAATAATGTATAACGAAAGGCCAGCTGAATTTGTTGGAACATTT
AATTATCATAATATGAATGAAATTAATGATTATTGGGTTAAATATGAAGGTGATTTCAAA
GATGATTTTAAAAATGGAGTTGGAACTCTTTATCTTTCAAACGGCGAAAGATATATAGGA
CGGTTCAAAAATGATATGGTACATGGTCGTGGTACTTTTTATAAGAGTGATGGATCATTC
ATCACAGCAGAATGGTCATAAAACATTCTTCTTAACTACTAATGA


>TTHERM_00947580(protein)
MGQILNKQKQKQADGPTKNIEIKSKLEVIQDLKHLDQTKNLIDVFPKYEQVYKFLEKKEH
RIYGEIFILAETNDPNIQIAVQESFFQNQFEFQMEVENLKEIESFTQQHQNLIQLIKYFD
YNYNSMCTSFHRLITVTEYLSRDLSTELFFRKLLIEKTTSSATPKNGESTTKSNQMQVSL
SSKSQRSLSANSVAVQNQSQVKNNSNMLHSKRLSEIQRKSVLIVTKVFSTHENDNIIEDQ
GEDEGNFYEKRGAIAKQIKNRSHFQFNASDNAYRFQEKEFTYILKSLISGLCYLQMQNRT
HQCLRSSSIFIARDGTIKLTDPHLFNQSSLYTYIYKGQSVSGAYLSPLLVSNVEYSVVKP
EHNEYKSDVFTLAVIMLEIAYLNKLDNYFDYTEYCLVDVEGLQILAENLKDIYSQSIISL
LLQMLDENEDIRPDFVSLAQKLGIFNASTNAVVQLSKNDSQSVIYSKLASSTSSNQKPIP
QATSIIIQPSDQSFTSQSPRFSKTNESNQQQSIQNATPKITQISDAKQKQNNFTQILNPY
TQDTVRKSKELQITEKNSKLQNQANSRSLTPNREKTPNNVPLIPITNSSQDAQTSSPQIA
TKSEKHESICNDMLTPKRPQLAENLDNNYRFMTPLPQVRLQTPDNTTIQKHMHLLNQTPL
TKTKQQPFFNKGVSPIKTESTASDIQRTLKTESSIDPQRYHARSTSPIMHHQSSPSKQPI
TPKSDFNKIISSQYTPTQVRMSINQSNHSSYPLNTSPFYQQSYSPISSYQTEKSPISTNN
NNNNQNLSPISNYSTQQQNKIKETQNTLTNSKAQSRKNSNSNQIQSQNSYQPLSKQQSTV
SPINTKQETKPTLSRQSLSAINIQQVGNLSNNRNSISDSSKAFNLVNSSRSPSPITSKST
QQIKKMINQSEEKPSSASIQIQQHIQNKKNEQKNSQQSLQLSNNQSTNSNNQIALKKLSI
SNPQSILPTKYQSQSSTVEKDIISFSRQPTFAPSQIGQQQKPPSLKSSLQQNKQSLQNLN
VFTPQSQISNGVNVQAYLSSQSTVNRYSYGNIQIINQFDNKSPALTKLSNLSAANNLNGN
NQTQHEPQSQKNYTGVAQKKGSVLRINQNVKSQKHGSLQINEQQTFGQQSIQSSVNNNSQ
TDSMTESSQQMKSSSRQSQKSHRQSQSGNQFQYRSKTEIGNEQDVITQDNQKFYDNFFKS
DKSPVIQSNLQLLNLKQQQQKPQQETIYKPYIPKMCINTNNDQQAFSSQNFNNSKQQNGG
KLIEGLGDLKPASELFSNNKNKDQPKSKAQIEESQQKSLKQSVSSNLSQSSANKIQKRNS
NQIDINANEVSNKNIKNELTMSQINRELEKHRNFSKKLQEEMERQKQQQQILQQQIVNSS
SKITEDQNNLIPTLEKQKSINTIIDQHIFDNQLRQTPSDIVFPFSNQNYSSTNDQPFKSY
NHTGTFGKQPSSDNQNQEQIQNDILQNGQAEDKEEEEKPKKTSPPKEFGTDYIDQLIAKF
KSEITSQIQTSNNQPNKQSSDAAEITQPNNTNLSKNTNSIIPSYTSYYATKTDLNNQPQS
QNEYQNVSPSNINQNDQQNKTNLNIASNNNLTGEKYADQPASSERIMKRVESDSIGIGFA
GFNAKAQIQLQKKGSLNNFQDEKIASNDFPVVGSRADLPKSPNSYIKQNFTEIHSIPLSQ
LQKAEALQGLDCQELKGQLSQQLKAKKRYSINEKYQNEKEKINLETQQDSSISSNVQEAS
SVYKGNSKQNYENMAGYKDSIEQISQNTSVSNNSQSIQIVLPKQTNLFGEKQQNQTQVNN
GTDSYGNFVNNQILHTDKSGNDLQRALNEKKQEGDQNNIQMQIYKQNTFGTNAPALMDAI
KKGNYVTEDLSQQYQSAQFNNFNSQNGINPPFISFAQISQQSNLNSIENIISTNYQSEIK
FDHLNGYGDAQYKLANKFNQNIGEQLKSNNKQTYEEDRSETNNILIINNNDSQREDYVNN
QFCHLQREAVIEYKTPKTKQSSEQVLTPTSDDAIKNFLDRVEKNNAYQIPNDFLSNYVQN
NQININNTQNEQNMYAVISEGENINSKLLDIKTPLNTNQYFNNGNFSGGGSSSIYKLTIT
PPQKDQLETPPTNTNIQVYEFENENVAAFSDEHQFQYQNQQYYNNVMDGCQNISNIQKIN
EDETYNSKRSFDASADLLMMRSNQDIQEGIETSNFNYQANMMANPNFLNSPKKTNRNQVQ
SNNQNQNQYNIQQSDRNNNSKNNQINQQNYTSNSNLSPNKNYLFTPSPTRKDDSAQFNQT
FSDIQMIQFLKNKENVIETYEDGSYYEGEKMNGVRHGRGKFFYGDGGSFQGEWQNGHMNG
YGVLYYPSQNKAYEGEWDDDKFNGKGIMYNERPAEFVGTFNYHNMNEINDYWVKYEGDFK
DDFKNGVGTLYLSNGERYIGRFKNDMVHGRGTFYKSDGSFITAEWSQNILLNYQ


>TTHERM_00947580(gene)
ATGGGATAAATATTGAATAAGCAAAAATAGAAGTAGGCTGATGGACCTACAAAAAATATA
GAAATAAAATCCAAACTTGAAGTTATTTAGGATTTAAAGCATTTAGACTAGACGAAAAAT
TTAATAGATGTCTTCCCTAAATACGAATAAGTATATAAATTCTTAGAAAAGAAAGAACAC
AGAATATATGGAGAAATATTCATATTGGCAGAAACCAACGATCCAAATATTCAAATAGCC
GTTTAAGAAAGTTTTTTCTAAAACTAGTTTGAGTTTTAAATGGAAGTAGAAAATTTAAAA
GAAATAGAAAGCTTCACTTAATAGCATTAAAATTTAATTTAACTTATTAAATACTTTGAT
TATAATTACAATTCTATGTGCACTTCTTTTCATAGGCTTATAACTGTAACAGAATATCTT
TCAAGAGACCTTTCAACAGAATTATTCTTTAGGAAATTATTAATTGAAAAAACAACATCA
AGCGCTACCCCTAAAAATGGGGAAAGTACAACTAAATCTAATTAAATGTAAGTAAGCTTG
TCTTCAAAAAGCTAAAGAAGTCTTTCTGCAAACAGCGTTGCAGTTCAGAATTAATCTTAA
GTGAAAAATAACAGCAACATGTTACATTCAAAAAGACTTTCAGAAATCTAAAGAAAAAGT
GTACTCATTGTAACAAAAGTATTTTCCACTCATGAAAATGACAACATTATAGAAGATCAA
GGAGAAGATGAAGGCAACTTTTATGAAAAAAGAGGAGCAATAGCAAAATAGATAAAAAAT
AGGAGCCACTTTTAATTTAATGCATCGGATAATGCTTACAGATTTTAGGAAAAAGAATTT
ACTTACATATTAAAATCCCTTATATCAGGATTGTGTTACCTATAAATGTAGAATAGAACT
CATCAATGTCTTCGCTCATCATCCATTTTCATAGCTCGAGACGGTACTATCAAGCTCACA
GACCCTCATTTGTTTAATCAATCTTCTCTCTACACATACATTTACAAAGGGCAGTAATAA
TATATAAATATATTTTTATCTTTAATAAAAAATTAGTTGTTCAATAATACTAAATTTAAT
CTTAAAAACACAATTTTCATAATAGACTTGAACATATTGTTACATTTAATTACAGTCAAA
AATGTAATCAGAAATTCTCAAATATTTTATAGATATTTTTAATTTAAAAATAAAAATTAT
ATTCTAAAAAAAATCAAATTAAATTAATTTAAAGAATTAATGAATATTAAAAAAATTACT
TTTAAATATGATTTGATCAATTTTATTAAAAAAATATAAAAATTTTATTTTTAAAAAGTA
AGATTTCTATTTTATGAAATAGTTCAATTGATATTTTAGTTTTTTTTTAATTCAGAATAA
AAATAATTAATGAAATTAAGTAAAATATTTGTAAAATATTCTAGATCAGTCAGTGGAGCA
TATTTATCACCTTTGCTAGTTAGTAATGTAGAATATTCAGTAGTAAAGCCTGAGCATAAC
GAATACAAAAGCGATGTTTTCACATTGGCTGTGATAATGTTAGAAATAGCTTATTTAAAT
AAGTTAGATAACTACTTCGACTACACTGAATACTGTTTAGTTGATGTTGAAGGTTTGTAG
ATTCTAGCAGAAAATTTAAAAGATATATACTCACAATCTATAATATCTCTTTTACTTTAA
ATGCTTGATGAAAATGAAGATATCAGACCAGATTTTGTCTCCTTAGCTTAAAAGTTAGGA
ATATTTAATGCTAGTACTAATGCAGTTGTTTAGCTTTCCAAAAATGATTCATAGAGCGTA
ATTTATTCTAAATTAGCGTCATCCACATCTTCAAACCAAAAACCAATACCTTAAGCAACA
TCAATTATTATATAACCTTCAGATTAATCATTTACATCTTAATCACCTAGATTTTCTAAG
ACTAATGAATCAAATCAATAGCAATCGATATAGAATGCAACACCAAAAATAACATAAATC
TCTGATGCTAAGTAAAAATAAAATAATTTTACTCAAATTTTAAACCCATACACTTAAGAC
ACAGTTAGGAAGAGTAAAGAATTATAAATAACCGAAAAAAATTCTAAACTGTAAAACTAA
GCTAATTCAAGATCACTAACTCCAAATAGAGAAAAAACTCCAAATAATGTTCCTTTGATA
CCAATAACGAATTCTTCATAAGATGCTTAAACTAGTTCTCCATAAATTGCAACAAAATCT
GAAAAACATGAATCAATATGTAATGATATGTTAACTCCAAAGAGACCTTAACTAGCTGAG
AATTTAGACAATAATTACAGATTTATGACTCCTTTACCTTAAGTAAGACTGTAAACTCCT
GATAACACTACAATATAGAAACATATGCACTTACTGAATCAAACGCCTTTGACAAAAACT
AAGCAATAACCATTTTTTAACAAAGGAGTTTCTCCAATAAAAACAGAAAGTACTGCATCA
GACATTCAAAGAACCTTGAAAACTGAAAGCTCAATTGATCCATAAAGATATCATGCAAGA
TCTACTTCTCCAATTATGCATCATTAGTCTAGCCCTTCGAAATAACCAATTACACCGAAA
TCAGATTTCAATAAAATAATAAGTAGCCAATATACTCCTACATAAGTAAGAATGAGCATA
AATCAATCTAATCATTCATCTTATCCTTTAAATACAAGTCCTTTTTATTAGTAAAGCTAT
TCTCCAATCAGTTCATACTAAACAGAAAAATCACCAATTAGTACAAACAATAACAACAAC
AACTAAAACTTATCTCCAATAAGCAACTATTCTACATAATAACAAAACAAAATCAAAGAA
ACATAAAAGTAAAATTCAAATTTTTTATTTTTAATTTTAATCAAATTTATAAAATATATT
TAGCACTTTGACCAATTCTAAAGCTTAGAGCAGAAAAAATTCAAATTCAAACTAAATATA
ATCATAGAATTCATATCAACCTTTGAGTAAATAGCAGAGTACAGTTTCTCCCATCAATAC
AAAATAAGAAACAAAGCCAACATTATCAAGATAGTCTTTATCTGCAATTAATATTTAGCA
AGTTGGTAATTTGAGTAATAATAGAAACAGTATAAGTGATTCATCTAAGGCATTTAATTT
AGTAAACAGTTCAAGATCACCTTCTCCCATAACAAGTAAAAGTACTCAACAAATAAAAAA
AATGATTAATTAAAGTGAAGAAAAACCCTCATCTGCAAGTATTTAAATACAATAACATAT
TCAGAATAAAAAAAATGAGTAAAAAAATAGCTAACAAAGTCTATAATTATCTAACAATTA
ATCAACAAATTCAAACAACTAAATTGCATTAAAAAAATTGTCTATTTCTAACCCTTAAAG
TATATTACCAACAAAATATTAATCTTAGAGTTCAACAGTTGAAAAGGATATTATATCCTT
TAGCAGATAACCTACTTTTGCTCCTTCTTAAATTGGGTAATAATAGAAACCTCCATCATT
AAAATCTTCATTGCAATAAAATAAACAATCTCTATAAAATCTAAACGTCTTTACACCCCA
AAGGTAAATTAATTTATAATTCATCAAGTAAATTTATTTGAAATGTTATTTAAAAAAGCT
AAATTTCAAATGGTGTAAATGTTTAAGCATATCTCTCATCTTAATCTACTGTTAATAGAT
ATAGCTATGGTAATATATAGATTATAAACTAGTTTGATAATAAATCTCCTGCTCTTACTA
AATTATCCAACCTTTCTGCAGCTAACAATTTAAATGGTAATAACTAAACTTAACATGAAC
CTCAAAGCCAAAAAAATTATACAGGAGTTGCTTAAAAAAAAGGTTCTGTTTTAAGAATAA
ATTAAAACGTAAAATCTTAAAAGCATGGTAGTTTATAAATTAATGAATAACAAACATTTG
GATAGTAATCCATTCAGAGTTCAGTTAACAATAATAGCTAAACAGACTCAATGACTGAAT
CTTCATAGTAGATGAAAAGCTCCTCTCGATAATCTCAAAAATCTCATAGATAAAGCTAAT
CAGGTATAATAAGCAATTAAACTAGTTTTTTGTTTAATTTATATTAATTTTTAACATAAA
ATTCATCAAAATATCAAACAAAACTAAATTTAAATTATTATAAAATAAAAATAGGGAACT
AATTTTAGTACAGAAGTAAAACAGAAATAGGGAATGAATAAGATGTAATAACTTAAGATA
ATTAAAAATTCTACGATAACTTTTTTAAAAGCGATAAATCTCCAGTAATTTAATCAAATC
TTTAGCTTTTAAATTTAAAGTAGCAACAATAAAAGCCTTAGTAAGAGACTATATACAAAC
CATACATCCCTAAAATGTGCATAAATACTAATAATGATTAATAAGCTTTCAGCTCTTAAA
ATTTCAATAATTCCAAGTAATAAAATGGGGGAAAACTAATTGAAGGGCTAGGAGATCTAA
AACCTGCAAGCGAGTTATTTTCGAATAACAAGAACAAAGATTAACCAAAATCAAAAGCAT
AAATAGAAGAAAGTCAATAAAAATCTCTTAAATAGTCTGTATCTTCAAATTTAAGTTAAT
CTTCAGCAAATAAAATCCAAAAAAGAAATTCAAATCAAATTGATATTAATGCAAATGAGG
TTTCTAACAAAAATATCAAAAATGAACTCACTATGAGTTAAATTAACAGGGAATTAGAAA
AACATAGGAATTTTTCTAAAAAGCTTTAAGAAGAAATGGAAAGATAAAAGCAATAACAGT
AAATATTATAATAGCAAATTGTTAATTCTTCATCAAAAATTACTGAAGATTAAAATAATT
TAATACCTACATTAGAAAAATAGAAATCTATCAACACAATTATAGACTAGCACATATTTG
ACAATCAACTTAGATAAACTCCCTCTGATATTGTTTTTCCTTTTTCCAATCAAAATTATT
CTTCAACAAATGATCAGCCCTTTAAATCATATAACCACACAGGCACTTTTGGGAAATAAC
CCTCAAGTGATAATTAAAATCAAGAATAAATTTAAAATGATATATTATAAAATGGATAAG
CTGAAGACAAGGAAGAAGAAGAAAAACCTAAGAAGACTTCACCTCCTAAGGAGTTTGGTA
CAGATTACATTGATTAATTGATAGCTAAATTTAAATCTGAAATCACAAGTTAAATATAAA
CAAGCAATAACCAACCAAATAAATAATCATCTGATGCTGCAGAAATAACTCAACCAAACA
ATACAAACTTGTCAAAAAACACAAACTCTATTATTCCAAGCTATACTAGCTACTATGCTA
CAAAAACAGACCTAAATAATCAACCACAATCGTAAAATGAGTATTAAAATGTTTCTCCAA
GCAATATAAATTAGAATGATTAGTAAAATAAAACTAATTTAAATATTGCATCGAACAACA
ACTTGACTGGTGAAAAATATGCAGATTAGCCAGCTAGTTCTGAAAGAATTATGAAGAGAG
TAGAAAGTGACAGTATAGGAATAGGCTTTGCAGGATTTAATGCAAAAGCTTAAATTTAGC
TTTAAAAGAAGGGAAGTCTAAATAATTTTTAAGATGAAAAAATAGCTTCTAACGATTTCC
CCGTTGTAGGAAGTAGGGCAGATCTACCAAAAAGCCCAAACAGCTACATTAAATAAAACT
TTACAGAAATTCACTCTATACCTCTTTCTCAGCTGTAGAAGGCTGAAGCTTTACAAGGAC
TAGATTGTTAAGAATTAAAGGGGTAACTTAGCTAGTAACTTAAAGCTAAAAAAAGATATT
CAATAAATGAGAAATATCAAAATGAGAAGGAAAAAATAAATTTAGAAACTTAGCAAGATA
GTAGTATTTCTTCGAATGTATAAGAGGCAAGTTCTGTTTATAAAGGAAATAGTAAATAAA
ATTATGAAAATATGGCTGGTTATAAAGATAGCATAGAGTAAATTTCATAAAATACTTCTG
TCTCAAATAATAGTTAGTCAATTCAAATCGTACTTCCAAAGTAGACAAATTTATTTGGAG
AAAAATAGCAAAATTAAACTTAAGTAAACAATGGTACAGATTCATATGGGAATTTTGTTA
ATAATTAAATTTTACACACTGATAAAAGTGGAAATGATTTGTAGAGAGCACTTAATGAAA
AGAAATAAGAAGGAGATTAAAATAATATTTAGATGTAAATTTATAAACAAAACACATTTG
GTACTAATGCACCTGCACTTATGGATGCAATAAAGAAAGGCAACTACGTTACAGAAGATT
TAAGTTAACAATATTAGAGTGCATAGTTTAATAATTTTAATAGCTAGAACGGTATAAATC
CTCCTTTCATTAGCTTTGCTTAAATAAGCTAGCAAAGTAATTTAAATAGCATTGAAAATA
TTATTAGTACTAACTATTAAAGCGAAATTAAATTTGATCATTTGAATGGTTATGGTGATG
CTTAATATAAGCTAGCTAATAAATTTAATTAAAATATAGGAGAGTAATTGAAGAGTAATA
ACAAATAAACTTATGAAGAAGATAGAAGTGAAACAAATAACATTCTCATAATTAACAACA
ATGATAGTTAAAGAGAGGATTATGTAAACAATTAGTTCTGTCATTTGCAAAGAGAAGCTG
TAATTGAATATAAAACACCTAAAACAAAGTAATCTTCAGAATAGGTTCTTACTCCAACTT
CAGACGATGCAATTAAAAATTTCTTAGACAGGGTAGAAAAAAATAATGCTTATCAAATTC
CCAATGATTTCTTATCAAACTATGTTTAAAATAATTAAATAAACATTAATAATACTTAAA
ATGAATAGAACATGTATGCAGTAATCTCTGAAGGGGAAAATATAAATTCTAAACTATTAG
ACATTAAAACACCACTTAACACTAACTAATACTTCAATAATGGAAACTTTAGTGGAGGTG
GTAGTAGCAGCATTTACAAGTTAACAATAACACCACCTCAAAAAGATTAGCTCGAAACTC
CTCCCACAAACACAAATATTCAGGTATATGAATTTGAGAATGAAAACGTTGCTGCTTTCT
CAGATGAACATTAATTTTAATACTAAAATTAGCAATATTATAATAATGTGATGGATGGGT
GTTAAAATATTAGCAACATTTAAAAAATAAACGAAGATGAGACATATAATTCGAAGAGAA
GCTTTGACGCTTCTGCTGATTTACTAATGATGCGTAGTAACTAAGACATATAAGAAGGAA
TTGAAACCAGTAATTTTAATTACCAAGCTAATATGATGGCTAACCCAAATTTTTTGAACA
GTCCTAAAAAGACTAATCGTAATTAAGTTTAAAGTAATAATTAAAACTAAAACCAGTACA
ATATTCAATAATCAGACAGAAACAACAACAGCAAAAATAATTAAATCAATTAATAGAATT
ATACCAGTAATTCTAATTTAAGTCCAAACAAAAACTATTTATTCACTCCTTCTCCCACTA
GAAAAGATGATAGCGCACAATTCAATCAAACGTTTAGTGATATTCAGATGATATAGTTTT
TGAAAAACAAAGAAAACGTTATAGAGACTTATGAAGATGGGTCATATTACGAGGGTGAAA
AAATGAATGGAGTCCGTCATGGAAGAGGAAAATTCTTTTATGGAGATGGAGGCTCATTTT
AAGGCGAATGGTAAAATGGACACATGAATGGGTATGGAGTGCTTTATTATCCTTCTTAAA
ATAAAGCTTATGAAGGAGAATGGGATGATGATAAATTTAATGGTAAAGGAATAATGTATA
ACGAAAGGCCAGCTGAATTTGTTGGAACATTTAATTATCATAATATGAATGAAATTAATG
ATTATTGGGTTAAATATGAAGGTGATTTCAAAGATGATTTTAAAAATGGAGTTGGAACTC
TTTATCTTTCAAACGGCGAAAGATATATAGGACGGTTCAAAAATGATATGGTACATGGTC
GTGGTACTTTTTATAAGAGTGATGGATCATTCATCACAGCAGAATGGTCATAAAACATTC
TTCTTAACTACTAATGA