Identifiers and Description

Gene Model Identifier

TTHERM_00148890

Standard Name

MRNO27 (Membrane Occupation and Recognition Nexus protein other)

Aliases

PreTt20648 | 12.m00322 | 3700.m00044 | RSK3

Description

Protein with predicted MORN domains localized throughout the protein and/or associated with other domains having a predicted function. Protein kinase domain containing protein.

Genome Browser (Macronucleus)

GBrowse

Genome Browser (Micronucleus)

GBrowse

Gene Ontology Annotations

Molecular Function

Biological Process

Domains

  • ( PF02493 ) MORN repeat
  • ( PF07661 ) MORN repeat variant
  • ( PF00069 ) protein kinase domain
  • ( PF07714 ) protein tyrosine kinase
  • ( PF01779 ) ribosomal L29e protein family
  • ( PF04259 ) Small, acid-soluble spore protein, gamma-type

Gene Expression Profile

  • Tetrahymena Functional Genomics Database:

Change in Gene Expression

TMHMM

TMHMM

Signal Peptide

Signal Peptide Present?: No
Presense Probability: 10.1%

TetraMine Data

TTHERM_00148890

WebApollo

Fullscreen View

Tetrahymena Stock Center

No Data fetched for StockID

Homologs (v.2006 protein sequences)

SourceIdentifierScoreDescription
Tetrahymena borealisEI9_04951.19.997093137033517e-262protein kinase domain-containi
ng protein (1204 aa)
OxytrichaContig20548.0.g821.9994498063102785e-22MORN repeat
WormBaseWBGene000011210.0000000000009003435339752751locus:dyf-5 status:Confirmed
UniProt:B3WFY8 protein_id
:CAQ76489.2
Stentor CoeruleusSteCoe_366860.0000000001026187963170189
SGDYGL179C0.00000000039982266684865623TOS3 Protein kinase, related t
o and functionally redundant w
ith Elm1p and Sak1p for the ph
osphorylation and activation o
f Snf1p; functionally ortholog
ous to LKB1, a mammalian kinas
e associated with Peutz-Jegher
s cancer-susceptibility syndro
me

General Information

No Data fetched for General Information

Associated Literature

No Data fetched for Associated Literature

Sequences

>TTHERM_00148890(coding)
ATGGGAAATTAAAATTCTGATGTGAAAGCAAATGCAGATGAGCATTCGTAACTGATGGAA
AATTACATTACTGTCAAAAATATTTAGGATGAAAAGTATGGAGAAGGAGTTTTAATGCAA
AATAAACTTACAGGAGCATATTGTTTGTTAAAAGAATATAACTCTACAGATGATTATGAA
TTTGAAAAAGCATACTCAAAATACAAGAAAAGATAAGAGTTAAAACATGAAAATATTGTC
ATGCTTCTAGGCATAGCATAAAAGAAAGAGTCTTAACTATGCAGCACATTTTATAAATTG
TATGTTCTTTATGAGTATGTAAACGATAATCTAGAATAACATATTTAGCTTCACTAATAA
ACTGGTTAGCATTTTATAGAAAGTGAGCTATGGGATATTCTTATGTAAAGCGTTTCTGCA
TTAAGCTACTTATAGTAAAAAGGGATTACTCATTAGAATATCAAACCATCTAATATATTC
TTTGACTAAAATTAAATGGTTAAAATTGCTGATTCTTAGGTTATTTAATAAATGAATACT
TTTTCTTTAGTTGCAACTAACCCAAAAGAACCACCTAAAAACTCATATCTTTCTCCTGCT
TTGATAGAGGCATTGGCATAAAATAACTGGTCTCCAAACCATGATACATCTAAAAGTGAT
ATTTTTAGTCTTGGTATGACTATCATAAGTGCAGGTTTACTCGAGGATCTTGATTCTTGT
TATATTTACTATCCTGAACCAGCTTTCTAAGAAGATATTTTTAAATAAAAATTTAATTAA
TTCAAATCAAACTACAGCAGCAAACTAACGAATATCTTAGGGATAATGACATCACTTGGT
GAAGAAACAAGACCTGATTTTAACTAGTTATGGAATTAATTGTAGTAATTTTAAGTTAAG
AATCCTCACTAGCCAAGCAACATTTAAGTTGGACATGAAAAATAGAATTATGACTAAAGC
AACCCACAGCTAGACTTATAAAATAGATATTAAAATCATTATATCCATGAATAATAAAAA
GATTTGCATTAAGGTGAAATAGTTGGATAAAATAATCATAAAATGAAGTAATCTCCAAGC
ACACAGCCAAAAATTGTTAACGAGGACAATGAAAATGTTGTTGATGATACAGAAGACTCA
GTTGATTAAATAAAGAGATAAAATCCTCAAAACTACAACAAAAATTATGCTGAAAAACAA
TAATTTAATTAATTGGCTTAGCACTAATAGGAAGTTAGAACTCCAGCTGTGCCTTCAAGG
TCTATATCATAATCAGGTAAAATAGAAGGAAGTAATCCTCTTAAAAATAGCAATTTGAAT
TAAAATAATACTATTAAAACAAACTATGCGGTTAAATAAACTAGCAATATTCTGCCTCCT
TCAATACAAAGTACTTCATCCGTTACAAACAATAGTTTATCTTCCAAAGCACTTGCCCCT
GTTAATGCTAATTTTTCTTTACCTAGTCATCCTATGAGTAAAGATTTTGAAAGTTTATAA
TCATTGCTAATGAATGTCAAGACTATTTATATTTGCAAAACCTAACCAGATGAAAATACT
GGAGCTATAGAAAGAGGAACTGTGCGCTAAGGAGAAGTAGAACAATTCTTATAATCACAA
CAAAATAACAACCTAAATAGCTAATTTAATATAGATAATACTTACAATAACAATAATAAA
TATAATTAATAATAAGCTCTTAATAATACTTAGCAAAAGGCTTCTAGCAGATCTAATAGT
TTCTATAATAATTCTTCGAATATAAATTATAATAACAATTTAAATGGTAATATGAGAAGT
GGTAGTAGTGCTAATTTACATGCAAACAATAATATCACAGGTGCAGGAGGTATGCAATCT
CAAAACTAAGGAAACATAAATGGTAGCATGCAAAAAAACAATTCATTCCATAATAATAGC
TAAGCTAATTCTTCGCTTTTAAAGGATCACAATGTTTAAAACCTGAATGATATTTCAAAT
ATTCACAACTATTCGAACATTGATGACTTTAAAATTAGTAATTAGTAATCTAATATCTTT
AATAATAATCCTAAATTGTAGTAATAAATAACTTCTACAACACCCTACAAAGCTCAAAAT
CAATACCCATAAGAAAACAAAACAAAGTTAGATGATTTATAAAATATTAAAATTGTTAGC
TAGCAAAATAAAAGCTTTAGTAATAGCTTTTATGAAAATAATTTAAAAAATTAAAAAGAA
GATATAATCAAAAATAATCTGAATGGTATTAATTCTACTCCAACAACAGTAAATAATAAC
AATTTATCATCTTATTTACCTTAATACTAAGCTAAGAGTATTAATTTGACATCTAATAAT
ACTTCATTTAGCAATATTAATAATCAATCAAAACCTGCTTAATCATCGTTCCCTCTAACA
CAACAGTTCACAATTCCTTAATCAGCAAACGATGGAAAAAATCTTCTTACTAATTTTGAA
GAACTAAAATCGAAACTTCAGGAAGCTGAATTAAAAGCCAAGATGGAATATGAATCCAAA
TATGGATAAATAAGTTCTAATGCTACATCAAATTATGGCACAGTAATTTAATAAACAAAC
GATTATTCATAAAATATAGATTATTCAATACAATATGGGAAAGGAAATACAAAAGCAAAC
AATAATATTGATGACATTATTAAAAAATATGATATCAAAAATAACAATAATAGTAATAAT
AATAATAATACATCTTATGCGAATTTCAATTAAAGCTAAAGCAGCGATGGAGATTAAACT
CAAAAAAGAAACCAACAATACCTTGGAAATTCTGATGGATAAAATAATTAATATGTTATT
TCAAAAAATTTTTCTTCTTAAATGATGAATGAACCTGAAGAACAAGTCAAAAAATAAAAA
TAAGTAATATAACACACAAAATAATAATCAATGAGTGACGCTGCTTCAAGAAATATTACT
CCTGTTTCTAATGTCAAGACAAATGGTGCCCCTACATTTACTCCTGTTACTAATGTTTAG
AGCTTCTTAAATTAATCAGCTTAATCAAATCATAATTATTAACAATTTAGTCCTATGCAA
TCATAACAAAATAACTAATCCTAATAATATAAAGTTTAAGAAAATCTACCAAACTTTAAT
TACCAAAACTCAGATTATAATAATAATAATTAATTCTATTCAAATAGATTCAATAATGAA
ATACCAGAAGTAGTTATCGAAAATTATTAAAATGGATCTAGATATGAAGGTGAAAAAATG
AATGGTTTGAGACATGGATAGGGAAGATTCTTCTATCAAGATGGTGGTCTTTATGATGGA
GAATGGAAAGATAATAAAATGAATGGTAGAGGTGTGCTATATTATGCAAGTGGTAAAATT
GCATATGACGGATATTGGGAAGAAGATAAATTCCATGGTTTTGGAGCACTATTTAACGAA
AACCCTGCAGAATTGCTTAGTTTCTTTGATTATAGGGATTTTGATTAAGTTGACGAATAC
TGGATTAAATACGATGGAGAATTCAAAGATGATAATAAAGATGGTTTTGGAACTCTCTAT
CTCTCTAATGGAGAGAGGTTTGAGGGTAGTTTTAAAAATGATTTTGTTTGTGGTCCAGGA
TCTTTTTATAAAATAAATGGAGAAAAAGTAGATGGAATATGGTAAAATAATAAGCTAATT
TAATCTTGA


>TTHERM_00148890(protein)
MGNQNSDVKANADEHSQLMENYITVKNIQDEKYGEGVLMQNKLTGAYCLLKEYNSTDDYE
FEKAYSKYKKRQELKHENIVMLLGIAQKKESQLCSTFYKLYVLYEYVNDNLEQHIQLHQQ
TGQHFIESELWDILMQSVSALSYLQQKGITHQNIKPSNIFFDQNQMVKIADSQVIQQMNT
FSLVATNPKEPPKNSYLSPALIEALAQNNWSPNHDTSKSDIFSLGMTIISAGLLEDLDSC
YIYYPEPAFQEDIFKQKFNQFKSNYSSKLTNILGIMTSLGEETRPDFNQLWNQLQQFQVK
NPHQPSNIQVGHEKQNYDQSNPQLDLQNRYQNHYIHEQQKDLHQGEIVGQNNHKMKQSPS
TQPKIVNEDNENVVDDTEDSVDQIKRQNPQNYNKNYAEKQQFNQLAQHQQEVRTPAVPSR
SISQSGKIEGSNPLKNSNLNQNNTIKTNYAVKQTSNILPPSIQSTSSVTNNSLSSKALAP
VNANFSLPSHPMSKDFESLQSLLMNVKTIYICKTQPDENTGAIERGTVRQGEVEQFLQSQ
QNNNLNSQFNIDNTYNNNNKYNQQQALNNTQQKASSRSNSFYNNSSNINYNNNLNGNMRS
GSSANLHANNNITGAGGMQSQNQGNINGSMQKNNSFHNNSQANSSLLKDHNVQNLNDISN
IHNYSNIDDFKISNQQSNIFNNNPKLQQQITSTTPYKAQNQYPQENKTKLDDLQNIKIVS
QQNKSFSNSFYENNLKNQKEDIIKNNLNGINSTPTTVNNNNLSSYLPQYQAKSINLTSNN
TSFSNINNQSKPAQSSFPLTQQFTIPQSANDGKNLLTNFEELKSKLQEAELKAKMEYESK
YGQISSNATSNYGTVIQQTNDYSQNIDYSIQYGKGNTKANNNIDDIIKKYDIKNNNNSNN
NNNTSYANFNQSQSSDGDQTQKRNQQYLGNSDGQNNQYVISKNFSSQMMNEPEEQVKKQK
QVIQHTKQQSMSDAASRNITPVSNVKTNGAPTFTPVTNVQSFLNQSAQSNHNYQQFSPMQ
SQQNNQSQQYKVQENLPNFNYQNSDYNNNNQFYSNRFNNEIPEVVIENYQNGSRYEGEKM
NGLRHGQGRFFYQDGGLYDGEWKDNKMNGRGVLYYASGKIAYDGYWEEDKFHGFGALFNE
NPAELLSFFDYRDFDQVDEYWIKYDGEFKDDNKDGFGTLYLSNGERFEGSFKNDFVCGPG
SFYKINGEKVDGIWQNNKLIQS


>TTHERM_00148890(gene)
ATGGGAAATTAAAATTCTGATGTGAAAGCAAATGCAGATGAGCATTCGTAACTGATGGAA
AATTACATTACTGTCAAAAATATTTAGGATGAAAAGTATGGAGAAGGAGTTTTAATGCAA
AATAAACTTACAGGAGCATATTGTTTGTTAAAAGAATATAACTCTACAGATGATTATGAA
TTTGAAAAAGCATACTCAAAATACAAGAAAAGATAAGAGTTAAAACATGAAAATATTGTC
ATGCTTCTAGGTAAATATTTCAATAATTGCAACTTTACAAAAATATTGAAACTTCTTATT
CTATATTTTAAAAAATGGCAAATTTAGATAGATAGATTGCATAAAATAATTCATTTGATT
TATGAAAAATTAAATTACTTAAAATAAACTTACAATTTTATCATATTTATAGGCATAGCA
TAAAAGAAAGAGTCTTAACTATGCAGCACATTTTATAAATTGTATGTTCTTTATGAGTAT
GTAAACGATAATCTAGAATAACATATTTAGCTTCACTAATAAACTGGTTAGCATTTTATA
GAAAGTGAGCTATGGGATATTCTTATGTAAAGCGTTTCTGCATTAAGCTACTTATAGTAA
AAAGGGATTACTCATTAGAATATCAAACCATCTAATATATTCTTTGACTAAAATTAAATG
GTTAAAATTGCTGATTCTTAGGTTATTTAATAAATGAATACTTTTTCTTTAGTTGCAACT
AACCCAAAAGAACCACCTAAAAACTCATATCTTTCTCCTGCTTTGATAGAGGTAATATCT
AAACATATAATTTATACTTATTTTTATTCATTTTTAATCATAAATTCAGGCATTGGCATA
AAATAACTGGTCTCCAAACCATGATACATCTAAAAGTGATATTTTTAGTCTTGGTATGAC
TATCATAAGTGCAGGTTTACTCGAGGATCTTGATTCTTGTTATATTTACTATCCTGAACC
AGCTTTCTAAGAAGATATTTTTAAATAAAAATTTAATTAATTCAAATCAAACTACAGCAG
CAAACTAACGAATATCTTAGGGATAATGACATCACTTGGTGAAGAAACAAGACCTGATTT
TAACTAGTTATGGAATTAATTGTAGTAATTTTAAGTTAAGAATCCTCACTAGCCAAGCAA
CATTTAAGTAAATAATGAGCTCAATGTCTTATTTAAATTATGTTTAATTAGTTAATTTTT
AAGCACTTATGGTTTAAATTCAAAAAGTTCATTAAATATTGTTTTAATTTTATTGATGAT
TAAGTTCAAATGCATTTCATTCAAATAAGCTTTTAAATTGATTGATTATTTTATATGAAT
AGGTTGGACATGAAAAATAGAATTATGACTAAAGCAACCCACAGCTAGACTTATAAAATA
GATATTAAAATCATTATATCCATGAATAATAAAAAGATTTGCATTAAGGTGAAATAGTTG
GATAAAATAATCATAAAATGAAGTAATCTCCAAGCACACAGCCAAAAATTGTTAACGAGG
ACAATGAAAATGTTGTTGATGATACAGAAGACTCAGTTGATTAAATAAAGAGATAAAATC
CTCAAAACTACAACAAAAATTATGCTGAAAAACAATAATTTAATTAATTGGCTTAGCACT
AATAGGAAGTTAGAACTCCAGCTGTGCCTTCAAGGTCTATATCATAATCAGGTAAAATAG
AAGGAAGTAATCCTCTTAAAAATAGCAATTTGAATTAAAATAATACTATTAAAACAAACT
ATGCGGTTAAATAAACTAGCAATATTCTGCCTCCTTCAATACAAAGTACTTCATCCGTTA
CAAACAATAGTTTATCTTCCAAAGCACTTGCCCCTGTTAATGCTAATTTTTCTTTACCTA
GTCATCCTATGAGTAAAGATTTTGAAAGTTTATAATCATTGCTAATGAATGTCAAGACTA
TTTATATTTGCAAAACCTAACCAGATGAAAATACTGGAGCTATAGAAAGAGGAACTGTGC
GCTAAGGAGAAGTAGAACAATTCTTATAATCACAACAAAATAACAACCTAAATAGCTAAT
TTAATATAGATAATACTTACAATAACAATAATAAATATAATTAATAATAAGCTCTTAATA
ATACTTAGCAAAAGGCTTCTAGCAGATCTAATAGTTTCTATAATAATTCTTCGAATATAA
ATTATAATAACAATTTAAATGGTAATATGAGAAGTGGTAGTAGTGCTAATTTACATGCAA
ACAATAATATCACAGGTGCAGGAGGTATGCAATCTCAAAACTAAGGAAACATAAATGGTA
GCATGCAAAAAAACAATTCATTCCATAATAATAGCTAAGCTAATTCTTCGCTTTTAAAGG
ATCACAATGTTTAAAACCTGAATGATATTTCAAATATTCACAACTATTCGAACATTGATG
ACTTTAAAATTAGTAATTAGTAATCTAATATCTTTAATAATAATCCTAAATTGTAGTAAT
AAATAACTTCTACAACACCCTACAAAGCTCAAAATCAATACCCATAAGAAAACAAAACAA
AGTTAGATGATTTATAAAATATTAAAATTGTTAGCTAGCAAAATAAAAGCTTTAGTAATA
GCTTTTATGAAAATAATTTAAAAAATTAAAAAGAAGATATAATCAAAAATAATCTGAATG
GTATTAATTCTACTCCAACAACAGTAAATAATAACAATTTATCATCTTATTTACCTTAAT
ACTAAGCTAAGAGTATTAATTTGACATCTAATAATACTTCATTTAGCAATATTAATAATC
AATCAAAACCTGCTTAATCATCGTTCCCTCTAACACAACAGTTCACAATTCCTTAATCAG
CAAACGATGGAAAAAATCTTCTTACTAATTTTGAAGAACTAAAATCGAAACTTCAGGAAG
CTGAATTAAAAGCCAAGATGGAATATGAATCCAAATATGGATAAATAAGTTCTAATGCTA
CATCAAATTATGGCACAGTAATTTAATAAACAAACGATTATTCATAAAATATAGATTATT
CAATACAATATGGGAAAGGAAATACAAGTAATTTTTTAAACATATTTATAAATTTTTAAT
ATTTAATTTTATTTAAAATTAGAAGCAAACAATAATATTGATGACATTATTAAAAAATAT
GATATCAAAAATAACAATAATAGTAATAATAATAATAATACATCTTATGCGAATTTCAAT
TAAAGCTAAAGCAGCGATGGAGATTAAACTCAAAAAAGAAACCAACAATACCTTGGAAAT
TCTGATGGATAAAATAATTAATATGTTATTTCAAAAAATTTTTCTTCTTAAATGATGAAT
GAACCTGAAGAACAAGTCAAAAAATAAAAATAAGTAATATAACACACAAAATAATAATCA
ATGAGTGACGCTGCTTCAAGAAATATTACTCCTGTTTCTAATGTCAAGACAAATGGTGCC
CCTACATTTACTCCTGTTACTAATGTTTAGAGCTTCTTAAATTAATCAGCTTAATCAAAT
CATAATTATTAACAATTTAGTCCTATGCAATCATAACAAAATAACTAATCCTAATAATAT
AAAGTTTAAGAAAATCTACCAAACTTTAATTACCAAAACTCAGATTATAATAATAATAAT
TAATTCTATTCAAATAGATTCAATAATGAAATACCAGAAGTAGTTATCGAAAATTATTAA
AATGGATCTAGATATGAAGGTGAAAAAATGAATGGTTTGAGACATGGATAGGGAAGATTC
TTCTATCAAGATGGTGGTCTTTATGATGGAGAATGGAAAGATAATAAAATGAATGGTAGA
GGTGTGCTATATTATGCAAGTGGTAAAATTGCATATGACGGATATTGGGAAGAAGATAAA
TTCCATGGTTTTGGAGCACTATTTAACGAAAACCCTGCAGAATTGCTTAGTTTCTTTGAT
TATAGGGATTTTGATTAAGTTGACGAATACTGGATTAAATACGATGGAGAATTCAAAGAT
GATAATAAAGATGGTTTTGGAACTCTCTATCTCTCTAATGGAGAGAGGTTTGAGGGTAGT
TTTAAAAATGATTTTGTTTGTGGTCCAGGATCTTTTTATAAAATAAATGGAGAAAAAGTA
GATGGAATATGGTAAAATAATAAGCTAATTTAATCTTGA