Identifiers and Description

Gene Model Identifier

TTHERM_01084140

Standard Name

MRNO26 (Membrane Occupation and Recognition Nexus protein other)

Aliases

PreTt05933 | 225.m00036 | 3801.m00213

Description

protein kinase; Protein with predicted MORN domains localized throughout the protein and/or associated with other domains having a predicted function. Sequence similarity to a protein kinase family unique to Tetrahymena thermophila (Eisen et al.- 2006).

Genome Browser (Macronucleus)

GBrowse

Genome Browser (Micronucleus)

GBrowse

Gene Ontology Annotations

No Data fetched for Gene Ontology Annotations

Domains

No Data fetched for Domains

Gene Expression Profile

  • Tetrahymena Functional Genomics Database:

Change in Gene Expression

TMHMM

TMHMM

Signal Peptide

Signal Peptide Present?: No
Presense Probability: 10.1%

TetraMine Data

TTHERM_01084140

WebApollo

Fullscreen View

Tetrahymena Stock Center

No Data fetched for StockID

Homologs (v.2006 protein sequences)

SourceIdentifierScoreDescription
Tetrahymena borealisEI9_20464.19.997093137033517e-262hypothetical protein (1082 aa)
OxytrichaContig3993.0.g1069.995317835403734e-19MORN repeat
SGDYBR097W0.0002999184360822198VPS15 Myristoylated serine/thr
eonine protein kinase involved
in vacuolar protein sorting;
functions as a membrane-associ
ated complex with Vps34p; acti
ve form recruits Vps34p to the
Golgi membrane; interacts wit
h the GDP-bound form of Gpa1p
DictyBaseDDB_G02925501DDB_G0292550 on chromosome: 6
position 1642791 to 1647510

General Information

No Data fetched for General Information

Associated Literature

No Data fetched for Associated Literature

Sequences

>TTHERM_01084140(coding)
ATGGGATAGTCATTAGGAAAAGAAGAAGTAGAGTAAACAAAGGAACTATTTTATAAGTAG
TACTCTTTTATTGAAGATAAGCAAGATTTACATTATGGATAGATTAAGGTTTTCGAAAGA
AATTATGAATTTGAAAATTCTCAATAGCTAAATTAAGATGAAGGAAAAGATACAAAAAAG
TCTGCTAAGCAAAGATTGTATTAGAAGGCACGCACTTTAGCTATAAAAGAAAGTGTTTAT
TAAGATTTAGATACCATAGACAAGGACTTGGTGAATATGAAATAACTTATTCATATAACA
GAAGAAAATCATAAAGAAAAGCGAACTAAGAATTTAATTGATGTATATGAGTACTTTATA
CAAACAGAAGAAAAATTTTGTAGTTCAGTATAAAGAATTTAATTAGTTATAGAATATTTG
CAAAGAGACATATAAATTGAAGTAAAAACAAAGAAACTACAAAACTAAAGGTTTACTCCT
CAAGAAATATTTACAATTGCTTTCAGTTGTATTAACTCTCTTTATAATTTGTAGCTTGTT
AATTTGGCTCATGGCGATTTAAAGACATCTAATATTTTAGTTTCTGAATATTTTGAAATA
AAACTTTTGCACCCACTAGTTAACAAAATAGTACCTAGCTTTGCTACTATGATTTCATAA
TTAAGTTATGGTGAGCACTTTGACACACAAGGAATTTATCTTTCTCCTTTATTGACAAAA
GCTGTTTCCTAAAAAAATTATTAGCCTCAACACAATCCATTCAAATCAGACGTATTTACT
TTAGGAATTATACTAATCGAATGCTGTAATCTAGGAACTGTCGATAATTTATATAATTAT
GAGGCAGGAGATTTTAATGAAAATTAGCTTAAGATTCATATGAATATAATTAAGAATTAG
TATGGTGTAGATGTCCATGATTTAATTGCAAGAATGGTAAAAGTATAGGAATAAGATCGT
CCTGATTTTATAGAACTAGCTACTTAGCTTAACATCATAAATTAAATGAATGAAGTATAT
AACTAATAACAGTAGATGATTGAATAGCAAGCTTCTTTAAAAGTTGCTCCTGCTTCTGAT
AAATATGGTGTTTCTCTTTTTAAAGCACTAAATACAGAGGCAGAAGAATATAATTATAGT
TAGAAACAAAATTCTGCTTCTAATTCTTTTGTATAAAATAACAATTAGAGCATTACAGCA
GCAAGTAGTGCTCTTAACCCAAATAATAGTTTGAATTAAAATAATATAACTTCATCATAA
TAACCTAGCACAAATATTTAATCTCCAAATACTTTTGCATAATAAAGCTCCCAGTCATCT
TAAATAGCTGCTACTTAAAGTTTCTCTTTTTAAGGAAATCCAAATAATTTAGAAAACACT
AATAATCCAACTCAAGTTAAACCTAATGCATTTTTCCCTTAGTATTCTTAAAATTAGATA
GCAGCCTCTACCTATTAGCAAAATTCTAACTAGCAATATTAGAGTTAATAGGTTTCTATT
CCACCAGCAAATCCCAAAAACTAGAATTTATCAAGGTAATAGTCGCAAGACGTTCTCTAA
AACTAAGTTATAAATTAATCACATAATTTTGGTAATATCAACTAAACCCCAATCAGTGGG
GTAACTTTAGTTAAGAATAGCAGTTAAACTACAAACTCTAATTACTAACCAACATTACTT
TAATATCATCTTAAGCCCCCATCAGTTCCTTATAATATTTAAAATCAGTAAGGCAATAAT
GTACCAGCTAATCCAAACTTATAGTAACAATAACAATTTAATAGTAATGGAAGCACAAAC
TTATCTCAAATAAATTCCGGCTAGGTTTAGTAAAGCTATTCAGGAATAACTCCAATTTAA
AGTTCCAATTAATAGTAAAGCTATTAATTTTCTAATAATTTGATAGGAAATTAAATTAAT
TTATAGAATTAACCATAAAAACTATAACCACCTCCAACAGATTAAAATCTAGGTCAAGCA
AACTATTAAGGATTTACAAACTTTAGTTTGCCAGGCTATGACAACAATAATGCAGGTATT
AATTTATAATATAATCAGATTTCTCAGCCTTAGACTAATAATGGCTAAAATTATCAAATT
CCAGAAGATGTATAAAAAATTATAAATGAATTTAAAGAAAAATAAAAAATAAACGATTAA
ATATACTCTGAAAAAGAAAAGCTGTCTTAAAGTAATGTTAAGTACTAAGTAATTCCAAAA
TAAGAGAGTCCTAATAAAATTGAGCAAAATTCCAGCAGAAGTGTAGTAAATATATCACCT
TAAAATAATAATAATTTAAGTGGATAGAGCAATACTCAATTCAACATCTATCCTGACTAA
AAATAATTTACAAATATCTAAGTTTCATAGCAATAACCTATTTAAAACTTGACTTATTAA
TAGCAAGAATAAATTGCATAGTAGTTGCTAGGAAATAACATATAAAATCCTGTAATCCAA
TAGTCTGCATTTTCTAATCCGATGACTACTAGCTAGCTTTAAGCTTAATAGCTGGCCGGA
TTGACAAATAGCTAAAATTAATTCATTTTAAGAAGCTAAAATCAATAACAGTACATATAA
TAACCTCCCCAATAATAGCTCATATAAGCTCCAACTTAAATATAAGGAAATTAATTTTAT
GCAGCTCTTCAATAGAATTAGAGCTTTAATCCTATGAGTGTCTAACCTTAAGCAACAAAT
GTTTTCACTTCTACTGATTCATAAAGAAATAAATATGAGCATATTCATGAAACTTATGAT
GATTCATCACATTATATTGGTGAAAAATTAGGTGGTTTAAGGCATGGTACTGGAAAATTT
TTTTATGCTGATGGAGGGTACTATGAAGGAGAGTGGTGTGAAGGTAGAATGGAAGGTTTG
GGTACTTTGTATTATCCTTCTGGAAGCTTGGCTTATCTAGGATAATGGAGAAATGATTAG
TTTAATGGAAAAGGCACTGTTTATAATGAATCTCCTGCACAAATTATTGGAGAGTTTGAT
TATACAAATTTTGATAATCTTGGAGAATATTGGGTTAAATACGAAGGTGATTTTAAAGAT
GATAACAAGGAAGGGATAGGAACTATATATCTCTCAAACGGAGATAGGTTTACAGGAAAT
TTCAATAATGACTTTGTTCATGGATAAGGAACCTATTTTAGAGAGAATAAAAATCCTGTT
TCTGGTATTTGGGATTGCAACCATTTAATATAATATTTATGA


>TTHERM_01084140(protein)
MGQSLGKEEVEQTKELFYKQYSFIEDKQDLHYGQIKVFERNYEFENSQQLNQDEGKDTKK
SAKQRLYQKARTLAIKESVYQDLDTIDKDLVNMKQLIHITEENHKEKRTKNLIDVYEYFI
QTEEKFCSSVQRIQLVIEYLQRDIQIEVKTKKLQNQRFTPQEIFTIAFSCINSLYNLQLV
NLAHGDLKTSNILVSEYFEIKLLHPLVNKIVPSFATMISQLSYGEHFDTQGIYLSPLLTK
AVSQKNYQPQHNPFKSDVFTLGIILIECCNLGTVDNLYNYEAGDFNENQLKIHMNIIKNQ
YGVDVHDLIARMVKVQEQDRPDFIELATQLNIINQMNEVYNQQQQMIEQQASLKVAPASD
KYGVSLFKALNTEAEEYNYSQKQNSASNSFVQNNNQSITAASSALNPNNSLNQNNITSSQ
QPSTNIQSPNTFAQQSSQSSQIAATQSFSFQGNPNNLENTNNPTQVKPNAFFPQYSQNQI
AASTYQQNSNQQYQSQQVSIPPANPKNQNLSRQQSQDVLQNQVINQSHNFGNINQTPISG
VTLVKNSSQTTNSNYQPTLLQYHLKPPSVPYNIQNQQGNNVPANPNLQQQQQFNSNGSTN
LSQINSGQVQQSYSGITPIQSSNQQQSYQFSNNLIGNQINLQNQPQKLQPPPTDQNLGQA
NYQGFTNFSLPGYDNNNAGINLQYNQISQPQTNNGQNYQIPEDVQKIINEFKEKQKINDQ
IYSEKEKLSQSNVKYQVIPKQESPNKIEQNSSRSVVNISPQNNNNLSGQSNTQFNIYPDQ
KQFTNIQVSQQQPIQNLTYQQQEQIAQQLLGNNIQNPVIQQSAFSNPMTTSQLQAQQLAG
LTNSQNQFILRSQNQQQYIQQPPQQQLIQAPTQIQGNQFYAALQQNQSFNPMSVQPQATN
VFTSTDSQRNKYEHIHETYDDSSHYIGEKLGGLRHGTGKFFYADGGYYEGEWCEGRMEGL
GTLYYPSGSLAYLGQWRNDQFNGKGTVYNESPAQIIGEFDYTNFDNLGEYWVKYEGDFKD
DNKEGIGTIYLSNGDRFTGNFNNDFVHGQGTYFRENKNPVSGIWDCNHLIQYL


>TTHERM_01084140(gene)
ATGGGATAGTCATTAGGAAAAGAAGAAGTAGAGTAAACAAAGGAACTATTTTATAAGTAG
TACTCTTTTATTGAAGATAAGCAAGATTTACATTATGGATAGATTAAGGTTTTCGAAAGA
AATTATGAATTTGAAAATTCTCAATAGCTAAATTAAGATGAAGGAAAAGATACAAAAAAG
TCTGCTAAGCAAAGATTGTATTAGAAGGCACGCACTTTAGCTATAAAAGAAAGTGTTTAT
TAAGATTTAGATACCATAGACAAGGACTTGGTGAATATGAAATAACTTATTCATATAACA
GAAGAAAATCATAAAGAAAAGCGAACTAAGAATTTAATTGATGTATATGAGTACTTTATA
CAAACAGAAGAAAAATTTTGTAGTTCAGTATAAAGAATTTAATTAGTTATAGAATATTTG
CAAAGAGACATATAAATTGAAGTAAAAACAAAGAAACTACAAAACTAAAGGTTTACTCCT
CAAGAAATATTTACAATTGCTTTCAGTTGTATTAACTCTCTTTATAATTTGTAGCTTGTT
AATTTGGCTCATGGCGATTTAAAGACATCTAATATTTTAGTTTCTGAATATTTTGAAATA
AAACTTTTGCACCCACTAGTTAACAAAATAGTACCTAGCTTTGCTACTATGATTTCATAA
TTAAGTTATGGTGAGCACTTTGACACACAAGGAATTTATCTTTCTCCTTTATTGACAAAA
GCTGTTTCCTAAAAAAATTATTAGCCTCAACACAATCCATTCAAATCAGACGTATTTACT
TTAGGTAATATTTGAAATATAATAAATAAGTATATAAATGAATATTATCCTTTCAAAGAT
ATCTAATACAAATTATAGTTTAGAGTTCAAATTAAAATAATTTTATTTGTAAATTATCTT
AGGAATTATACTAATCGAATGCTGTAATCTAGGAACTGTCGATAATTTATATAATTATGA
GGCAGGAGATTTTAATGAAAATTAGCTTAAGATTCATATGAATATAATTAAGAATTAGTA
TGGTGTAGATGTCCATGATTTAATTGCAAGAATGGTAAAAGTATAGGAATAAGATCGTCC
TGATTTTATAGAACTAGCTACTTAGCTTAACATCATAAATTAAATGAATGAAGTATATAA
CTAATAACAGTAGATGATTGAATAGCAAGCTTCTTTAAAAGTTGCTCCTGCTTCTGATAA
ATATGGTGTTTCTCTTTTTAAAGCACTAAATACAGAGGCAGAAGAATATAATTATAGTTA
GAAACAAAATTCTGCTTCTAATTCTTTTGTATAAAATAACAATTAGAGCATTACAGCAGC
AAGTAGTGCTCTTAACCCAAATAATAGTTTGAATTAAAATAATATAACTTCATCATAATA
ACCTAGCACAAATATTTAATCTCCAAATACTTTTGCATAATAAAGCTCCCAGTCATCTTA
AATAGCTGCTACTTAAAGTTTCTCTTTTTAAGGAAATCCAAATAATTTAGAAAACACTAA
TAATCCAACTCAAGTTAAACCTAATGCATTTTTCCCTTAGTATTCTTAAAATTAGATAGC
AGCCTCTACCTATTAGCAAAATTCTAACTAGCAATATTAGAGTTAATAGGTTTCTATTCC
ACCAGCAAATCCCAAAAACTAGAATTTATCAAGGTAATAGTCGCAAGACGTTCTCTAAAA
CTAAGTTATAAATTAATCACATAATTTTGGTAATATCAACTAAACCCCAATCAGTGGGGT
AACTTTAGTTAAGAATAGCAGTTAAACTACAAACTCTAATTACTAACCAACATTACTTTA
ATATCATCTTAAGCCCCCATCAGTTCCTTATAATATTTAAAATCAGTAAGGCAATAATGT
ACCAGCTAATCCAAACTTATAGTAACAATAACAATTTAATAGTAATGGAAGCACAAACTT
ATCTCAAATAAATTCCGGCTAGGTTTAGTAAAGCTATTCAGGAATAACTCCAATTTAAAG
TTCCAATTAATAGTAAAGCTATTAATTTTCTAATAATTTGATAGGAAATTAAATTAATTT
ATAGAATTAACCATAAAAACTATAACCACCTCCAACAGATTAAAATCTAGGTCAAGCAAA
CTATTAAGGATTTACAAACTTTAGTTTGCCAGGCTATGACAACAATAATGCAGGTATTAA
TTTATAATATAATCAGATTTCTCAGCCTTAGACTAATAATGGCTAAAATTATCAAATTCC
AGAAGATGTATAAAAAATTATAAATGAATTTAAAGAAAAATAAAAAATAAACGATTAAAT
ATACTCTGAAAAAGAAAAGCTGTCTTAAAGTAATGTTAAGTACTAAGTAATTCCAAAATA
AGAGAGTCCTAATAAAATTGAGCAAAATTCCAGCAGAAGTGTAGTAAATATATCACCTTA
AAATAATAATAATTTAAGTGGATAGAGCAATACTCAATTCAACATCTATCCTGACTAAAA
ATAATTTACAAATATCTAAGTTTCATAGCAATAACCTATTTAAAACTTGACTTATTAATA
GCAAGAATAAATTGCATAGTAGTTGCTAGGAAATAACATATAAAATCCTGTAATCCAATA
GTCTGCATTTTCTAATCCGATGACTACTAGCTAGCTTTAAGCTTAATAGCTGGCCGGATT
GACAAATAGCTAAAATTAATTCATTTTAAGAAGCTAAAATCAATAACAGTACATATAATA
ACCTCCCCAATAATAGCTCATATAAGCTCCAACTTAAATATAAGGAAATTAATTTTATGC
AGCTCTTCAATAGAATTAGAGCTTTAATCCTATGAGTGTCTAACCTTAAGGTAAAAATAA
TTAAAAATTTTATTAAATTAAACCTGTTTTTTATTAAAAGCAACAAATGTTTTCACTTCT
ACTGATTCATAAAGAAATAAATATGAGCATATTCATGAAACTTATGATGATTCATCACAT
TATATTGGTGAAAAATTAGGTAAAGTATTTAATAAAAATAGATTATTTTATTAAAGATAT
AATTTATCTGTAAAGGTGGTTTAAGGCATGGTACTGGAAAATTTTTTTATGCTGATGGAG
GGTACTATGAAGGAGAGTGGTGTGAAGGTAGAATGGAAGGTTTGGGTACTTTGTATTATC
CTTCTGGAAGCTTGGCTTATCTAGGATAATGGAGAAATGATTAGTTTAATGGAAAAGGCA
CTGTTTATAATGAATCTCCTGCACAAATTATTGGAGAGTTTGATTATACAAATTTTGATA
ATCTTGGAGAATATTGGGTTAAATACGAAGGTATTTAATAAAAAAACTTTAATTAATCTT
TAATTTTTTTAAAATTAAAAAATTAGGTGATTTTAAAGATGATAACAAGGAAGGGATAGG
AACTATATATCTCTCAAACGGAGATAGGTTTACAGGAAATTTCAATAATGACTTTGTTCA
TGGATAAGGAACCTATTTTAGAGAGAATAAAAATCCTGTTTCTGGTATTTGGGATTGCAA
CCATTTAATATAATATTTATGA