Identifiers and Description

Gene Model Identifier

TTHERM_01084140

Standard Name

MRNO26 (Membrane Occupation and Recognition Nexus protein other)

Aliases

PreTt05933 | 225.m00036 | 3801.m00213

Description

Protein with predicted MORN domains localized throughout the protein and/or associated with other domains having a predicted function. Sequence similarity to a protein kinase family unique to Tetrahymena thermophila (Eisen et al., 2006)."

Genome Browser (Macronucleus)

GBrowse

Genome Browser (Micronucleus)

GBrowse

Gene Ontology Annotations

No Data fetched for Gene Ontology Annotations

Domains

No Data fetched for Domains

Gene Expression Profile

  • Tetrahymena Functional Genomics Database:

Change in Gene Expression

TMHMM

TMHMM

Signal Peptide

Signal Peptide Present?: No
Presense Probability: 10.1%

TetraMine Data

TTHERM_01084140

WebApollo

Fullscreen View

Tetrahymena Stock Center

No Data fetched for StockID

Homologs (v.2006 protein sequences)

SourceIdentifierScoreDescription
Tetrahymena borealisEI9_20464.19.997093137033517e-262hypothetical protein (1082 aa)
OxytrichaContig3993.0.g1069.995317835403734e-19MORN repeat
SGDYBR097W0.0002999184360822198VPS15 Myristoylated serine/thr
eonine protein kinase involved
in vacuolar protein sorting;
functions as a membrane-associ
ated complex with Vps34p; acti
ve form recruits Vps34p to the
Golgi membrane; interacts wit
h the GDP-bound form of Gpa1p
DictyBaseDDB_G02925501DDB_G0292550 on chromosome: 6
position 1642791 to 1647510

General Information

No Data fetched for General Information

Associated Literature

No Data fetched for Associated Literature

Sequences

>TTHERM_01084140(coding)
ATGGGATAGTCATTAGGAAAAGAAGAAGTAGAGTAAACAAAGGAACTATTTTATAAGTAG
TACTCTTTTATTGAAGATAAGCAAGATTTACATTATGGATAGATTAAGGTTTTCGAAAGA
AATTATGAATTTGAAAATTCTCAATAGCTAAATTAAGATGAAGGAAAAGATACAAAAAAG
TCTGCTAAGCAAAGATTGTATTAGAAGGCACGCACTTTAGCTATAAAAGAAAGTGTTTAT
TAAGATTTAGATACCATAGACAAGGACTTGGTGAATATGAAATAACTTATTCATATAACA
GAAGAAAATCATAAAGAAAAGCGAACTAAGAATTTAATTGATGTATATGAGTACTTTATA
CAAACAGAAGAAAAATTTTGTAGTTCAGTATAAAGAATTTAATTAGTTATAGAATATTTG
CAAAGAGACATATAAATTGAAGTAAAAACAAAGAAACTACAAAACTAAAGGTTTACTCCT
CAAGAAATATTTACAATTGCTTTCAGTTGTATTAACTCTCTTTATAATTTGTAGCTTGTT
AATTTGGCTCATGGCGATTTAAAGACATCTAATATTTTAGTTTCTGAATATTTTGAAATA
AAACTTTTGCACCCACTAGTTAACAAAATAGTACCTAGCTTTGCTACTATGATTTCATAA
TTAAGTTATGGTGAGCACTTTGACACACAAGGAATTTATCTTTCTCCTTTATTGACAAAA
GCTGTTTCCTAAAAAAATTATTAGCCTCAACACAATCCATTCAAATCAGACGTATTTACT
TTAGGAATTATACTAATCGAATGCTGTAATCTAGGAACTGTCGATAATTTATATAATTAT
GAGGCAGGAGATTTTAATGAAAATTAGCTTAAGATTCATATGAATATAATTAAGAATTAG
TATGGTGTAGATGTCCATGATTTAATTGCAAGAATGGTAAAAGTATAGGAATAAGATCGT
CCTGATTTTATAGAACTAGCTACTTAGCTTAACATCATAAATTAAATGAATGAAGTATAT
AACTAATAACAGTAGATGATTGAATAGCAAGCTTCTTTAAAAGTTGCTCCTGCTTCTGAT
AAATATGGTGTTTCTCTTTTTAAAGCACTAAATACAGAGGCAGAAGAATATAATTATAGT
TAGAAACAAAATTCTGCTTCTAATTCTTTTGTATAAAATAACAATTAGAGCATTACAGCA
GCAAGTAGTGCTCTTAACCCAAATAATAGTTTGAATTAAAATAATATAACTTCATCATAA
TAACCTAGCACAAATATTTAATCTCCAAATACTTTTGCATAATAAAGCTCCCAGTCATCT
TAAATAGCTGCTACTTAAAGTTTCTCTTTTTAAGGAAATCCAAATAATTTAGAAAACACT
AATAATCCAACTCAAGTTAAACCTAATGCATTTTTCCCTTAGTATTCTTAAAATTAGATA
GCAGCCTCTACCTATTAGCAAAATTCTAACTAGCAATATTAGAGTTAATAGGTTTCTATT
CCACCAGCAAATCCCAAAAACTAGAATTTATCAAGGTAATAGTCGCAAGACGTTCTCTAA
AACTAAGTTATAAATTAATCACATAATTTTGGTAATATCAACTAAACCCCAATCAGTGGG
GTAACTTTAGTTAAGAATAGCAGTTAAACTACAAACTCTAATTACTAACCAACATTACTT
TAATATCATCTTAAGCCCCCATCAGTTCCTTATAATATTTAAAATCAGTAAGGCAATAAT
GTACCAGCTAATCCAAACTTATAGTAACAATAACAATTTAATAGTAATGGAAGCACAAAC
TTATCTCAAATAAATTCCGGCTAGGTTTAGTAAAGCTATTCAGGAATAACTCCAATTTAA
AGTTCCAATTAATAGTAAAGCTATTAATTTTCTAATAATTTGATAGGAAATTAAATTAAT
TTATAGAATTAACCATAAAAACTATAACCACCTCCAACAGATTAAAATCTAGGTCAAGCA
AACTATTAAGGATTTACAAACTTTAGTTTGCCAGGCTATGACAACAATAATGCAGGTATT
AATTTATAATATAATCAGATTTCTCAGCCTTAGACTAATAATGGCTAAAATTATCAAATT
CCAGAAGATGTATAAAAAATTATAAATGAATTTAAAGAAAAATAAAAAATAAACGATTAA
ATATACTCTGAAAAAGAAAAGCTGTCTTAAAGTAATGTTAAGTACTAAGTAATTCCAAAA
TAAGAGAGTCCTAATAAAATTGAGCAAAATTCCAGCAGAAGTGTAGTAAATATATCACCT
TAAAATAATAATAATTTAAGTGGATAGAGCAATACTCAATTCAACATCTATCCTGACTAA
AAATAATTTACAAATATCTAAGTTTCATAGCAATAACCTATTTAAAACTTGACTTATTAA
TAGCAAGAATAAATTGCATAGTAGTTGCTAGGAAATAACATATAAAATCCTGTAATCCAA
TAGTCTGCATTTTCTAATCCGATGACTACTAGCTAGCTTTAAGCTTAATAGCTGGCCGGA
TTGACAAATAGCTAAAATTAATTCATTTTAAGAAGCTAAAATCAATAACAGTACATATAA
TAACCTCCCCAATAATAGCTCATATAAGCTCCAACTTAAATATAAGGAAATTAATTTTAT
GCAGCTCTTCAATAGAATTAGAGCTTTAATCCTATGAGTGTCTAACCTTAAGCAACAAAT
GTTTTCACTTCTACTGATTCATAAAGAAATAAATATGAGCATATTCATGAAACTTATGAT
GATTCATCACATTATATTGGTGAAAAATTAGGTGGTTTAAGGCATGGTACTGGAAAATTT
TTTTATGCTGATGGAGGGTACTATGAAGGAGAGTGGTGTGAAGGTAGAATGGAAGGTTTG
GGTACTTTGTATTATCCTTCTGGAAGCTTGGCTTATCTAGGATAATGGAGAAATGATTAG
TTTAATGGAAAAGGCACTGTTTATAATGAATCTCCTGCACAAATTATTGGAGAGTTTGAT
TATACAAATTTTGATAATCTTGGAGAATATTGGGTTAAATACGAAGGTGATTTTAAAGAT
GATAACAAGGAAGGGATAGGAACTATATATCTCTCAAACGGAGATAGGTTTACAGGAAAT
TTCAATAATGACTTTGTTCATGGATAAGGAACCTATTTTAGAGAGAATAAAAATCCTGTT
TCTGGTATTTGGGATTGCAACCATTTAATATAATATTTATGA


>TTHERM_01084140(protein)
MGQSLGKEEVEQTKELFYKQYSFIEDKQDLHYGQIKVFERNYEFENSQQLNQDEGKDTKK
SAKQRLYQKARTLAIKESVYQDLDTIDKDLVNMKQLIHITEENHKEKRTKNLIDVYEYFI
QTEEKFCSSVQRIQLVIEYLQRDIQIEVKTKKLQNQRFTPQEIFTIAFSCINSLYNLQLV
NLAHGDLKTSNILVSEYFEIKLLHPLVNKIVPSFATMISQLSYGEHFDTQGIYLSPLLTK
AVSQKNYQPQHNPFKSDVFTLGIILIECCNLGTVDNLYNYEAGDFNENQLKIHMNIIKNQ
YGVDVHDLIARMVKVQEQDRPDFIELATQLNIINQMNEVYNQQQQMIEQQASLKVAPASD
KYGVSLFKALNTEAEEYNYSQKQNSASNSFVQNNNQSITAASSALNPNNSLNQNNITSSQ
QPSTNIQSPNTFAQQSSQSSQIAATQSFSFQGNPNNLENTNNPTQVKPNAFFPQYSQNQI
AASTYQQNSNQQYQSQQVSIPPANPKNQNLSRQQSQDVLQNQVINQSHNFGNINQTPISG
VTLVKNSSQTTNSNYQPTLLQYHLKPPSVPYNIQNQQGNNVPANPNLQQQQQFNSNGSTN
LSQINSGQVQQSYSGITPIQSSNQQQSYQFSNNLIGNQINLQNQPQKLQPPPTDQNLGQA
NYQGFTNFSLPGYDNNNAGINLQYNQISQPQTNNGQNYQIPEDVQKIINEFKEKQKINDQ
IYSEKEKLSQSNVKYQVIPKQESPNKIEQNSSRSVVNISPQNNNNLSGQSNTQFNIYPDQ
KQFTNIQVSQQQPIQNLTYQQQEQIAQQLLGNNIQNPVIQQSAFSNPMTTSQLQAQQLAG
LTNSQNQFILRSQNQQQYIQQPPQQQLIQAPTQIQGNQFYAALQQNQSFNPMSVQPQATN
VFTSTDSQRNKYEHIHETYDDSSHYIGEKLGGLRHGTGKFFYADGGYYEGEWCEGRMEGL
GTLYYPSGSLAYLGQWRNDQFNGKGTVYNESPAQIIGEFDYTNFDNLGEYWVKYEGDFKD
DNKEGIGTIYLSNGDRFTGNFNNDFVHGQGTYFRENKNPVSGIWDCNHLIQYL


>TTHERM_01084140(gene)
ATGGGATAGTCATTAGGAAAAGAAGAAGTAGAGTAAACAAAGGAACTATTTTATAAGTAG
TACTCTTTTATTGAAGATAAGCAAGATTTACATTATGGATAGATTAAGGTTTTCGAAAGA
AATTATGAATTTGAAAATTCTCAATAGCTAAATTAAGATGAAGGAAAAGATACAAAAAAG
TCTGCTAAGCAAAGATTGTATTAGAAGGCACGCACTTTAGCTATAAAAGAAAGTGTTTAT
TAAGATTTAGATACCATAGACAAGGACTTGGTGAATATGAAATAACTTATTCATATAACA
GAAGAAAATCATAAAGAAAAGCGAACTAAGAATTTAATTGATGTATATGAGTACTTTATA
CAAACAGAAGAAAAATTTTGTAGTTCAGTATAAAGAATTTAATTAGTTATAGAATATTTG
CAAAGAGACATATAAATTGAAGTAAAAACAAAGAAACTACAAAACTAAAGGTTTACTCCT
CAAGAAATATTTACAATTGCTTTCAGTTGTATTAACTCTCTTTATAATTTGTAGCTTGTT
AATTTGGCTCATGGCGATTTAAAGACATCTAATATTTTAGTTTCTGAATATTTTGAAATA
AAACTTTTGCACCCACTAGTTAACAAAATAGTACCTAGCTTTGCTACTATGATTTCATAA
TTAAGTTATGGTGAGCACTTTGACACACAAGGAATTTATCTTTCTCCTTTATTGACAAAA
GCTGTTTCCTAAAAAAATTATTAGCCTCAACACAATCCATTCAAATCAGACGTATTTACT
TTAGGTAATATTTGAAATATAATAAATAAGTATATAAATGAATATTATCCTTTCAAAGAT
ATCTAATACAAATTATAGTTTAGAGTTCAAATTAAAATAATTTTATTTGTAAATTATCTT
AGGAATTATACTAATCGAATGCTGTAATCTAGGAACTGTCGATAATTTATATAATTATGA
GGCAGGAGATTTTAATGAAAATTAGCTTAAGATTCATATGAATATAATTAAGAATTAGTA
TGGTGTAGATGTCCATGATTTAATTGCAAGAATGGTAAAAGTATAGGAATAAGATCGTCC
TGATTTTATAGAACTAGCTACTTAGCTTAACATCATAAATTAAATGAATGAAGTATATAA
CTAATAACAGTAGATGATTGAATAGCAAGCTTCTTTAAAAGTTGCTCCTGCTTCTGATAA
ATATGGTGTTTCTCTTTTTAAAGCACTAAATACAGAGGCAGAAGAATATAATTATAGTTA
GAAACAAAATTCTGCTTCTAATTCTTTTGTATAAAATAACAATTAGAGCATTACAGCAGC
AAGTAGTGCTCTTAACCCAAATAATAGTTTGAATTAAAATAATATAACTTCATCATAATA
ACCTAGCACAAATATTTAATCTCCAAATACTTTTGCATAATAAAGCTCCCAGTCATCTTA
AATAGCTGCTACTTAAAGTTTCTCTTTTTAAGGAAATCCAAATAATTTAGAAAACACTAA
TAATCCAACTCAAGTTAAACCTAATGCATTTTTCCCTTAGTATTCTTAAAATTAGATAGC
AGCCTCTACCTATTAGCAAAATTCTAACTAGCAATATTAGAGTTAATAGGTTTCTATTCC
ACCAGCAAATCCCAAAAACTAGAATTTATCAAGGTAATAGTCGCAAGACGTTCTCTAAAA
CTAAGTTATAAATTAATCACATAATTTTGGTAATATCAACTAAACCCCAATCAGTGGGGT
AACTTTAGTTAAGAATAGCAGTTAAACTACAAACTCTAATTACTAACCAACATTACTTTA
ATATCATCTTAAGCCCCCATCAGTTCCTTATAATATTTAAAATCAGTAAGGCAATAATGT
ACCAGCTAATCCAAACTTATAGTAACAATAACAATTTAATAGTAATGGAAGCACAAACTT
ATCTCAAATAAATTCCGGCTAGGTTTAGTAAAGCTATTCAGGAATAACTCCAATTTAAAG
TTCCAATTAATAGTAAAGCTATTAATTTTCTAATAATTTGATAGGAAATTAAATTAATTT
ATAGAATTAACCATAAAAACTATAACCACCTCCAACAGATTAAAATCTAGGTCAAGCAAA
CTATTAAGGATTTACAAACTTTAGTTTGCCAGGCTATGACAACAATAATGCAGGTATTAA
TTTATAATATAATCAGATTTCTCAGCCTTAGACTAATAATGGCTAAAATTATCAAATTCC
AGAAGATGTATAAAAAATTATAAATGAATTTAAAGAAAAATAAAAAATAAACGATTAAAT
ATACTCTGAAAAAGAAAAGCTGTCTTAAAGTAATGTTAAGTACTAAGTAATTCCAAAATA
AGAGAGTCCTAATAAAATTGAGCAAAATTCCAGCAGAAGTGTAGTAAATATATCACCTTA
AAATAATAATAATTTAAGTGGATAGAGCAATACTCAATTCAACATCTATCCTGACTAAAA
ATAATTTACAAATATCTAAGTTTCATAGCAATAACCTATTTAAAACTTGACTTATTAATA
GCAAGAATAAATTGCATAGTAGTTGCTAGGAAATAACATATAAAATCCTGTAATCCAATA
GTCTGCATTTTCTAATCCGATGACTACTAGCTAGCTTTAAGCTTAATAGCTGGCCGGATT
GACAAATAGCTAAAATTAATTCATTTTAAGAAGCTAAAATCAATAACAGTACATATAATA
ACCTCCCCAATAATAGCTCATATAAGCTCCAACTTAAATATAAGGAAATTAATTTTATGC
AGCTCTTCAATAGAATTAGAGCTTTAATCCTATGAGTGTCTAACCTTAAGGTAAAAATAA
TTAAAAATTTTATTAAATTAAACCTGTTTTTTATTAAAAGCAACAAATGTTTTCACTTCT
ACTGATTCATAAAGAAATAAATATGAGCATATTCATGAAACTTATGATGATTCATCACAT
TATATTGGTGAAAAATTAGGTAAAGTATTTAATAAAAATAGATTATTTTATTAAAGATAT
AATTTATCTGTAAAGGTGGTTTAAGGCATGGTACTGGAAAATTTTTTTATGCTGATGGAG
GGTACTATGAAGGAGAGTGGTGTGAAGGTAGAATGGAAGGTTTGGGTACTTTGTATTATC
CTTCTGGAAGCTTGGCTTATCTAGGATAATGGAGAAATGATTAGTTTAATGGAAAAGGCA
CTGTTTATAATGAATCTCCTGCACAAATTATTGGAGAGTTTGATTATACAAATTTTGATA
ATCTTGGAGAATATTGGGTTAAATACGAAGGTATTTAATAAAAAAACTTTAATTAATCTT
TAATTTTTTTAAAATTAAAAAATTAGGTGATTTTAAAGATGATAACAAGGAAGGGATAGG
AACTATATATCTCTCAAACGGAGATAGGTTTACAGGAAATTTCAATAATGACTTTGTTCA
TGGATAAGGAACCTATTTTAGAGAGAATAAAAATCCTGTTTCTGGTATTTGGGATTGCAA
CCATTTAATATAATATTTATGA