Identifiers and Description

Gene Model Identifier

TTHERM_00136280

Standard Name

MRNO23 (Membrane Occupation and Recognition Nexus protein other)

Aliases

PreTt24353 | 10.m00402 | 3698.m00121

Description

Protein with predicted MORN domains localized throughout the protein and/or associated with other domains having a predicted function. Protein kinase domain containing protein.

Genome Browser (Macronucleus)

GBrowse

Genome Browser (Micronucleus)

GBrowse

Gene Ontology Annotations

Molecular Function

Biological Process

Domains

Gene Expression Profile

  • Tetrahymena Functional Genomics Database:

Change in Gene Expression

TMHMM

TMHMM

Signal Peptide

Signal Peptide Present?: No
Presense Probability: 10.2%

TetraMine Data

TTHERM_00136280

WebApollo

Fullscreen View

Tetrahymena Stock Center

No Data fetched for StockID

Homologs (v.2006 protein sequences)

SourceIdentifierScoreDescription
Tetrahymena borealisEI9_05793.19.997093137033517e-262protein kinase domain-containi
ng protein (661 aa)
OxytrichaContig15620.0.g613.999970367130025e-21MORN repeat
DictyBaseDDB_G03494880.0000000029989608248573072DDB_G0349488 on chromosome: 2
position 6912714 to 6914186
WormBaseWBGene000071350.00000005999527666938375locus:cdk-12 Cyclin-dependen
t kinase 12 status:Partially
_confirmed UniProt:P46551
protein_id:CAA84302.3
SGDYPR161C0.0000004998288985444982SGV1 Cyclin (Bur2p)-dependent
protein kinase that functions
in transcriptional regulation;
phosphorylates the carboxy-te
rminal domain of Rpo21p and th
e C-terminal repeat domain of
Spt5p; regulated by Cak1p; sim
ilar to metazoan CDK9 proteins

General Information

No Data fetched for General Information

Associated Literature

No Data fetched for Associated Literature

Sequences

>TTHERM_00136280(coding)
ATGGGTAACATTTGTGAGCCTTATTGTGCATGCAACTGCAATTGCGAAAACTAAAAAATA
CTAAAAGATTGCTAAGAAGGTTGTGGTAACTGTTTATAATGCGAAGATTGCCACCAATGC
ACGGAATGTGATCCTAGAATGATGAATCCTTGCTTGATCAGAGAAACTTCAAATAAGGAA
TTAATGATTGTATTAAAAGAATTTGACTTTAAAGGAGAAGCAGAAGATAAATGGTATGGG
GATGTTTAAATACTTGAGCATAAGATATAAAAAGAAATAGTTGTTCTTAAAATAGTTGAA
AGTAGCTCTGAAACAGAAGCAGAGTAAGTTCAGTAATAGTTTATAAGAAGAATTAAGCTT
AACCATGAACACATTGTTCGTTTGAGATATATTGTTCATAAGGCAGTAGATGCATTCTGT
TCTGTTATCTACAAAAGTTATTTATTTTTCGATTATTTGCTTACTGATTTAGCCACAGAC
TTAAAAAATCGCAACAAGAAGGGATTGTATTTCTCTGAAGATGAAATTTGGAATATGGCA
TATTGTTTGATAAATGGCATGAAATATTTGTATAGTGTTAATATTACTCATGGATGTGTA
AGAAGTAAAAATGTTTATATCACTTAATATGGTTCTTTTAAAGTAGCAGATCCTGGTCTT
TTTAACTATGAAGTTAACTATGACATTGTCTTCAATAATCAAGATAACAATCATAAAGGT
ATTATTCTGTCACCTGCTCAAGTTCATGGTTTAGAAAGGCATATCGAAACTCCTATTCAT
GACTAATAAAAATCTGATGTTTTTTGTATTGGAATGGTTATACTTGAAGCTGCTAGCTTA
TTAAGTGCAGACTCCTGCTTTGATTACTATCATGCATGGGTTTTAGAAGATAAAATTCAA
GATAGATTGAATGAAATTAAATCTAAGTACCACGACTCTTTATATTATATGCTTAAAGAG
ATGCTAACGATTAATGAAATTCAAAGACCTAATTTCCAAACTCTTTTTGAAAAAAATTAA
AGAAATCCAAAGTTTAAAACTATTTTGAATCATAATTATTAAGCTTAAGCGTAATTCCAA
ATCTAAAATCCTGACTAAAGCGATACAGCTTCTGTCTTGAATCAAAGTTATATGACTCAC
AAGCCTGCTCCTTAAGTATTAAACAGTGTAAAACCAAACAATTTAAATTTGGTGGCAAGT
AAACCTTTTGATAATTTTTCTATTATCGATGGAATAGGAGCTGCAGACGATGCTCCAAAC
TTTGGTATTTCTTAACATTAAAATGCAAACCAAGGCATTGATATATTAGGACTAGGAGGT
AATTCAAACTTTAATTTAAATAGCAACAATAACCTCTTAGGTTAGTTTTCAATGCCTCCT
CCAATGATGGGATTAGGATTTTCAAGCGCAGGAGTTGGTAATTATCTATCAGGTACATCA
GGTTTAGATTTTACTTCTAGTATGGCAGGAACAAAATTAGGAAGGGAAAAAATTAGTGAA
AATTATAAAAATGGTTCAAGATATGAAGGAGAAGTGAGAAATGGAGTTAGAGATGGAAAG
GGTAAATATTATTATAACAATGGCGGCTATTATGAAGGTTCCTGGAAGGATGGAAAGATG
AATGGTTAAGGCACTTTGTATTTCCCAGACGGTTCTACTGCTTATGATGGTAGCTGGAGA
GATGATTAATTTCATGGTTATGGTACACTTTATAATAACTCTGTTTAGCCACACTAAGGA
CCATTTGATTATAAAAATTTTAATAATTTGTAAGAAAAATGGTTAAAATATGAGGGTGAC
TTTAAGAGTGATTAAAAAGAGGGATTTGGTACTCTTTTTGTTTCTAATGGAGAAAGATAT
GTAGGTGGATTTAAATAAGATAAAATTCATGGTTAAGGCACTTTTTACACATAATCTAAT
TAAGTTATAAAAGGAAGATGGGCTAATAATTTTATGTCTTGA


>TTHERM_00136280(protein)
MGNICEPYCACNCNCENQKILKDCQEGCGNCLQCEDCHQCTECDPRMMNPCLIRETSNKE
LMIVLKEFDFKGEAEDKWYGDVQILEHKIQKEIVVLKIVESSSETEAEQVQQQFIRRIKL
NHEHIVRLRYIVHKAVDAFCSVIYKSYLFFDYLLTDLATDLKNRNKKGLYFSEDEIWNMA
YCLINGMKYLYSVNITHGCVRSKNVYITQYGSFKVADPGLFNYEVNYDIVFNNQDNNHKG
IILSPAQVHGLERHIETPIHDQQKSDVFCIGMVILEAASLLSADSCFDYYHAWVLEDKIQ
DRLNEIKSKYHDSLYYMLKEMLTINEIQRPNFQTLFEKNQRNPKFKTILNHNYQAQAQFQ
IQNPDQSDTASVLNQSYMTHKPAPQVLNSVKPNNLNLVASKPFDNFSIIDGIGAADDAPN
FGISQHQNANQGIDILGLGGNSNFNLNSNNNLLGQFSMPPPMMGLGFSSAGVGNYLSGTS
GLDFTSSMAGTKLGREKISENYKNGSRYEGEVRNGVRDGKGKYYYNNGGYYEGSWKDGKM
NGQGTLYFPDGSTAYDGSWRDDQFHGYGTLYNNSVQPHQGPFDYKNFNNLQEKWLKYEGD
FKSDQKEGFGTLFVSNGERYVGGFKQDKIHGQGTFYTQSNQVIKGRWANNFMS


>TTHERM_00136280(gene)
ATGGGTAACATTTGTGAGCCTTATTGTGCATGCAACTGCAATTGCGAAAACTAAAAAATA
CTAAAAGATTGCTAAGAAGGTTGTGGTAACTGTTTATAATGCGAAGATTGCCACCAATGC
ACGGAATGTGATCCTAGAATGATGAATCCTTGCTTGATCAGAGAAACTTCAAATAAGGAA
TTAATGATTGTATTAAAAGAATTTGACTTTAAAGGAGAAGCAGAAGATAAATGGTATGGT
AAGTAAATTAAAATAAAATAAATTGATTCTGAAAGTATTTATATAGTTTTCTAAAATCAT
ATTTAAAGGGGATGTTTAAATACTTGAGCATAAGATATAAAAAGAAATAGTTGTTCTTAA
AATAGTTGAAAGTAGCTCTGAAACAGAAGCAGAGTAAGTTCAGTAATAGTTTATAAGAAG
AATTAAGCTTAACCATGAACACATTGTTCGTTTGAGATGTAATAAATACATTTTTTATTT
TATTCCTTATTTGAAATGCTCATTTCATGTTGATTTTTGAAAAGATATTTTAAATAAAAT
AGAGTTTATTTTTTAAAAACTAAATAAAAGTGACTTTATATTTTTGAAATTTATAAAAAA
GATATTGTTCATAAGGCAGTAGATGCATTCTGTTCTGTTATCTACAAAGTATGCTCTTTA
ATTTAACGCTTTTTAAGAGAATTCTCTATTAAGATTTATTACTTTTTGAATATCTATTAA
TTCAAGTATATTTACATATGTTATTATAAATAAATTAGAGTTATTTATTTTTCGATTATT
TGCTTACTGATTTAGCCACAGACTTAAAAAATCGCAACAAGAAGGGATTGTATTTCTCTG
AAGATGAAATTTGGAATATGGCATATTGTTTGATAAATGGCATGAAATATTTGTATAGTG
TTAATATTACTCATGGATGTGTAAGAAGTAAAAATGTTTATATCACTTAATATGGTTCTT
TTAAAGTAGCAGATCCTGGTCTTTTTAACTATGAAGTTAACTATGACATTGTCTTCAATA
ATCAAGATAACAATCATAAAGGTATTATTCTGTCACCTGCTCAAGTTCATGTAAAGAAGA
ATATTTTTTCATATATTTTCAAATATTTAAAATAAAAATCATTATAATCATTAGCAAAAA
TAGCTTACTTACTTAAGTGATCAATTAAATTTAATTAAATAATCTATTAAATTTAAAAAG
ATAATCTTGTCAAATATGAATTAATAATTAGATAAATATAATGAGATAGCATGATTTAAT
TATCTAAAATTTATTTAATTAATATAGGGTTTAGAAAGGCATATCGAAACTCCTATTCAT
GACTAATAAAAATCTGATGTTTTTTGTATTGGAATGGTTATACTTGAAGCTGCTAGCTTA
TTAAGTGCAGACTCCTGCTTTGATTACTATCATGCATGGGTTTTAGAAGATAAAATTCAA
GATAGATTGAATGAAATTAAATCTAAGTACCACGACTCTTTATATTATATGCTTAAAGAG
ATGCTAACGATTAATGAAATTCAAAGACCTAATTTCCAAACTCTTTTTGAAAAAAATTAA
AGAAATCCAAAGTTTAAAACTATTTTGAATCATAATTATTAAGCTTAAGCGTAATTCCAA
ATCTAAAATCCTGACTAAAGCGATACAGCTTCTGTCTTGAATCAAAGTTATATGACTCAC
AAGCCTGCTCCTTAAGTATTAAACAGTGTAAAACCAAACAATTTAAATTTGGTGGCAAGT
AAACCTTTTGATAATTTTTCTATTATCGATGGAATAGGAGCTGCAGACGATGCTCCAAAC
TTTGGTATTTCTTAACATTAAAATGCAAACCAAGGCATTGATATATTAGGACTAGGAGGT
AATTCAAACTTTAATTTAAATAGCAACAATAACCTCTTAGGTTAGTTTTCAATGCCTCCT
CCAATGATGGGATTAGGATTTTCAAGCGCAGGAGTTGGTAATTATCTATCAGGTACATCA
GGTTTAGATTTTACTTCTAGTATGGCAGGAACAAGTAATTATTATTTTCTATTATAACAA
TATACTAAGCTGTTTTTGAATAGAATTAGGAAGGGAAAAAATTAGTGAAAATTATAAAAA
TGGTTCAAGATATGAAGGAGAAGTGAGAAATGGAGTTAGAGATGGAAAGGGTAAATATTA
TTATAACAATGGCGGCTATTATGAAGGTTCCTGGAAGGATGGAAAGATGAATGGTAATTA
TAATTTTAGTTTATTCTATATAATTTTAATTAAAAATTAATTTTTAGGTTAAGGCACTTT
GTATTTCCCAGACGGTTCTACTGCTTATGATGGTAGCTGGAGAGATGATTAATTTCATGG
TTATGGTACACTTTATAATAACTCTGTTTAGCCACACTAAGGACCATTTGATTATAAAAA
TTTTAATAATTTGTAAGAAAAATGGTTAAAATATGAGGGTGACTTTAAGAGTGATTAAAA
AGAGGGATTTGGTACTCTTTTTGTTTCTAATGGAGAAAGATATGTAGGTGGATTTAAATA
AGATAAAATTCATGGTTAAGGCACTTTTTACACATAATCTAATTAAGTTATAAAAGGAAG
ATGGGCTAATAATTTTATGTCTTGA