Identifiers and Description

Gene Model Identifier

TTHERM_00653900

Standard Name

MRNO19 (Membrane Occupation and Recognition Nexus protein other)

Aliases

PreTt12877 | 95.m00123 | 3825.m02530

Description

Protein with predicted MORN domains localized throughout the protein and/or associated with other domains having a predicted function. Protein kinase domain containing protein.

Genome Browser (Macronucleus)

GBrowse

Genome Browser (Micronucleus)

GBrowse

Gene Ontology Annotations

Molecular Function

Biological Process

Domains

Gene Expression Profile

  • Tetrahymena Functional Genomics Database:

TetraMine Data

TTHERM_00653900

WebApollo

Fullscreen View

Tetrahymena Stock Center

No Data fetched for StockID

Homologs (v.2006 protein sequences)

SourceIdentifierScoreDescription
Tetrahymena borealisEI9_00714.19.997093137033517e-262protein kinase domain-containi
ng protein (1069 aa)
OxytrichaContig3828.0.g191.9994498063102785e-22MORN repeat
WormBaseWBGene000011210.0000000000005000841553255702locus:dyf-5 status:Confirmed
UniProt:B3WFY8 protein_id
:CAQ76489.2
Stentor CoeruleusSteCoe_366860.0000000001026187963170189
SGDYDR477W0.000000009996807949091551SNF1 AMP-activated serine/thre
onine protein kinase found in
a complex containing Snf4p and
members of the Sip1p/Sip2p/Ga
l83p family; required for tran
scription of glucose-repressed
genes, thermotolerance, sporu
lation, and peroxisome biogene
sis
DictyBaseDDB_G02737210.00000009004106436083642cdk9-2 on chromosome: 2 positi
on 3321422 to 3323747

General Information

No Data fetched for General Information

Associated Literature

  1. Ref:SUPR000349

Sequences

>TTHERM_00653900(coding)
ATGGGAGCTGAACAATCAAAAGGTGAAGATTAAAACACAATCGAGCAAGTCCTTTAAAAA
TTCTAGTAGCAAGAGAAATTAAACCATCCTTCTTTTGGAGATATTTAGATTTTGAAAGAT
AAGTCCTCTGATAACTAAGTTGGTTTAAAGGAGTTTAATCTAACAGATGAAAGTGAATTT
GCCAAAACTATAGAGAAATTCAAACCTAAACTTGCACTTGACAATCCAAATTTGATTAAG
CTTCATAATTGCATACAAAATAAGGAAAGCCAATTCTGCTCTACTTTCTTTAAGGTCTAT
TTAGTATTTGAATATGTCAAAAATACTCTCGAATAAGAAGTTCAAGAAAGATCTAAGGAT
TAAAAGCAGCCTTTTAGTGAAGAGGAAATGTGGAATATTTTAACTAGCTGCATCTAAGGA
GCTCATTTCTTATACTAAAATAAGCTCAGCAACAATAATATCCGTCCTTCTACAATCTAC
ATTACTTCAAATGGAATTGTAAAATTAGCTGATCCTACTCTTTTCTCTTAATAAGGTTTA
TATCCTGCTGCTCTTTCTAGTCCCAATAACGTTCCTTAAGGTATCTACATCTCCCCAGAA
CTACTTAATGACATGTACCAACAATAGTATAATCCAGTATACAACTAACAAAAGGCAGAT
GTTTTCAGTATTGGTATGTGTATGCTTCATGCAGCTCTTCTTTAACCTTTGGATGACTTA
TATGATTATAAAACTTTCTAAATCAACGAAGCTTTACTCCACGAAAGATTAAATCAAGTA
AGAGAAAATTACGGAGATCTTCTCTACTAATACTTGTACCATATGCTCAATTTTAATGCT
GATGATCGTTAAGATATTGCTTATTTTTACTAGTAAATTAATCTCTAGTAGGAATATGCA
GAAACAGCTACTTTCTAATAAGCTGAAAATACTTCTGCTTAAATTCAAAAGCAGGTTGAA
TACACTACTACTTAAACTAGTGTAACTAAATCACCTGAAAGAGCCTACTAACCTTATGAA
GTTATTACTACTAAAACTATCAAGACTACAACAGTTCCAAAATAGGAGGAAGAAGTAGTG
AAGAGATCAGCTGCTAATCCAAATTATGGTTAAGTTTAAGTTTAAATTCAACAATAGCCT
TAGATAGTTATCTAAAAAATGTCTAATCAACCTACTGGTTATAGCTCTGCAGGCATGTTC
AAAGATTCTGAAGATAAAGGTAGTACAATCACCTTTATTCCAAAGGATCAAAACTCTAAG
AATGCTATTCCAGATGAAAATATTGGAAATGCTATTGGAGGAGGAGACACTTATTATCAA
TAGTAATAGCAAAGTGTTGACATTTAGCCTTAAATTGTTACAACATCTAATAATTATGTT
CTTCCATAAACCAACACATATGTTACTTAAACATACACTAGTCCTCCCTTAAATTAAGAC
TACACAGCCAAATATACCTCTCCAGTTACAACTACTACTGTTACATACACTAACCCAACT
GTCAATATTGCACCTTACACTCCACTTACTTAGTATTCTAGTTCAGTTGCTCCAGCAACT
TCGACATCAAAGTATTCATCTACTTTCTAGCCAACTAACACTTATGAACTCTAAAAAGGT
TCAGAAGTATCCAATACAAATACTGGAGCTGGTTATTATGTTTCTACTAAAGAATAGTTA
TATCAACCAGTTGCATAAACTACTAGCACAAATACCTAATTTACATCCGATTTGAGTAAG
CCTTACTAGACTACTTCTTATGGATTAAAAGAAAATAATTTTTCCTATATTCCAGGTCCT
AGTGCTAACACATATGGAAGTACTATTGGATTAAATTCTACTACAACTAATGTAGCAGTA
TAGAATGCATCACCTGCATTAACAACTCCTGCTTTAACTACAGTAAATTAAACTTCAACA
TCTAACACTCAACCTGTAGTCACCAAATAATCTATTGTAAATACTACCGTTCCTGCTGGT
TCAACTTCTTCATACACAGCTACTAATACTTATGTTTCCCCAGCTCTCTCTCATATTCTT
AAAAAGGACGAATCAATTGAAGAAGCTATTAAGCGTTCAGCTCCTCCACCTCTCAAGAGC
GAATTAATTTCTTCTCCATATTCAGCATAAGTTGCATAGAATAGTGGATCCAATTTCTAT
ACTCCAAGTATCACTACTACTTTGACTTAGCCTCCTATCTAAACCAACATTGCTACAGGA
ACAACTACAACTACCACAACTACTACAGTTAAAAACAGTAATCCTGTAACAACAATCACT
ACTTCAAATACTGGCTACGATGCATATAAGCCTTCAGATGAAATAGAAGCCATTCTTGCT
AAGTATAGAAACTAAAAGGAAACCATGTCTTAACTTGGTTTAAGTTCTAACACTGCTGAC
ATTAAAATTTCTAACAACTCTGTAGATGCACCATAAAATAACACAAATTTAGCAGGTGTT
AATACCTATACAACAACTACTACAACAACTATTGCTAATAATACAGTCACTCCTTCCTAT
CAAGCTTACACTCCATCATAAACCTATACAGCTAACTTATCTAATATTGGTGGTAATTAT
GATATCAGTAAACCTATCGAGAGTTTAAATAATCAATTTTAAGGTCTTAACATTAACTAA
AACCCAAATATTCAAGTATCCTAAGTTTAAAGCTAATACACTGCCCAATTCAATCCTTCT
TAGGTTTCAAATACCTACTAAACATCAACAGTAGGTACATCTAACTTAGGAGCAACAAAT
AGTAGTCCTTACACTTAAACATATAATATATAATAATCATTTGGATAATCTCAGCCTTAA
TCTTATTAATAGGAAACCTAATTAGTTAACGAGTACTAAACAGAAGAAAAGGAGTATGTT
ATTGAAAATTATTCTAACAATTCTAAGTATGAAGGAGAAAAACTCAATGGAATGAGACAT
GGTAGAGGTAAGTTCTACTATTAAGATGGTGGTCTTTTCGATGGTGAATGGAGAGAAAAT
AAGATGCATGGCAAGGGTATTTTAAGCTATGCAAGTGGTAAACCAGCTTATGATGGTGAC
TGGGTAGATGATAAATTCGAAGGTTTTGGAATTCTTTACAATGAAAATCCTGCTCCCTTA
AACTAACCCTATGATTTTAGCGATTTTGACAATGTTGAAGAATATTGGACAAAGTACGAA
GGTTAATTTAAGGATGATAACAAAGAAGGATATGGTACTTTATTCCTCTCTAATGGTGAA
AAGTTTGTTGGAACATTCTATAAAGATTTTGTTAATGGTGCAGGAACTTTCTATACCTTA
AATGGAGATGTCTTACAAGGACAATGGCACCAAAATAAGTTTATTGCCTGA


>TTHERM_00653900(protein)
MGAEQSKGEDQNTIEQVLQKFQQQEKLNHPSFGDIQILKDKSSDNQVGLKEFNLTDESEF
AKTIEKFKPKLALDNPNLIKLHNCIQNKESQFCSTFFKVYLVFEYVKNTLEQEVQERSKD
QKQPFSEEEMWNILTSCIQGAHFLYQNKLSNNNIRPSTIYITSNGIVKLADPTLFSQQGL
YPAALSSPNNVPQGIYISPELLNDMYQQQYNPVYNQQKADVFSIGMCMLHAALLQPLDDL
YDYKTFQINEALLHERLNQVRENYGDLLYQYLYHMLNFNADDRQDIAYFYQQINLQQEYA
ETATFQQAENTSAQIQKQVEYTTTQTSVTKSPERAYQPYEVITTKTIKTTTVPKQEEEVV
KRSAANPNYGQVQVQIQQQPQIVIQKMSNQPTGYSSAGMFKDSEDKGSTITFIPKDQNSK
NAIPDENIGNAIGGGDTYYQQQQQSVDIQPQIVTTSNNYVLPQTNTYVTQTYTSPPLNQD
YTAKYTSPVTTTTVTYTNPTVNIAPYTPLTQYSSSVAPATSTSKYSSTFQPTNTYELQKG
SEVSNTNTGAGYYVSTKEQLYQPVAQTTSTNTQFTSDLSKPYQTTSYGLKENNFSYIPGP
SANTYGSTIGLNSTTTNVAVQNASPALTTPALTTVNQTSTSNTQPVVTKQSIVNTTVPAG
STSSYTATNTYVSPALSHILKKDESIEEAIKRSAPPPLKSELISSPYSAQVAQNSGSNFY
TPSITTTLTQPPIQTNIATGTTTTTTTTTVKNSNPVTTITTSNTGYDAYKPSDEIEAILA
KYRNQKETMSQLGLSSNTADIKISNNSVDAPQNNTNLAGVNTYTTTTTTTIANNTVTPSY
QAYTPSQTYTANLSNIGGNYDISKPIESLNNQFQGLNINQNPNIQVSQVQSQYTAQFNPS
QVSNTYQTSTVGTSNLGATNSSPYTQTYNIQQSFGQSQPQSYQQETQLVNEYQTEEKEYV
IENYSNNSKYEGEKLNGMRHGRGKFYYQDGGLFDGEWRENKMHGKGILSYASGKPAYDGD
WVDDKFEGFGILYNENPAPLNQPYDFSDFDNVEEYWTKYEGQFKDDNKEGYGTLFLSNGE
KFVGTFYKDFVNGAGTFYTLNGDVLQGQWHQNKFIA


>TTHERM_00653900(gene)
ATGGGAGCTGAACAATCAAAAGGTGAAGATTAAAACACAATCGAGCAAGTCCTTTAAAAA
TTCTAGTAGCAAGAGAAATTAAACCATCCTTCTTTTGGAGATATTTAGATTTTGAAAGAT
AAGTCCTCTGATAACTAAGTTGGTTTAAAGGAGTTTAATCTAACAGATGAAAGTGAATTT
GCCAAAACTATAGAGAAATTCAAACCTAAACTTGCACTTGACAATCCAAATTTGATTAAG
CTTCATAGTAATTTAAAAATTAGCTTTAAGCTATATTTTTTATAATCTCTTCGTAGTCTA
ACAAGTTGAATTTTAAAATATTATGCCAAAAAATATGAAAGATCCTTGAAAATTTTTTGA
AATGAAGCATACCATTAAAATTGATAAATTTCAAAACAAAAAATAAAAAAAATAAATTAT
TTTTCTAACTTTTAACTTAAAAATTTGCTATTTTCATCACTAAAAGGATTAAAAGCACCA
TTAATAATAGAAAATTAACTTAATTGATAATTAACTACTCTTTTTAAAGAAAACTGTTTA
AGTTTTAATTTATTGATAATATCTTTTATATTAAAGATTGCATACAAAATAAGGAAAGCC
AATTCTGCTCTACTTTCTTTAAGGTCTATTTAGTATTTGAATATGTCAAAAATACTCTCG
AATAAGAAGTTCAAGAAAGATCTAAGGATTAAAAGCAGCCTTTTAGTGAAGAGGAAATGT
GGAATATTTTAACTAGCTGCATCTAAGGAGCTCATTTCTTATACTAAAATAAGCTCAGCA
ACAATAATATCCGTCCTTCTACAATCTACATTACTTCAAATGGAATTGTAAAATTAGCTG
ATCCTACTCTTTTCTCTTAATAAGGTTTATATCCTGCTGCTCTTTCTAGTCCCAATAACG
TTCCTTAAGGTATCTACATCTCCCCAGAACTACTTAATGTATAAATTTCAGTTTCTTATT
TCTATTTGACATTTAAAAATTAAAATGATATACCCTATAATTATAGAGCTTAAAATATGT
TTAACCAAAGTTTTAATTCTTAATAACCTCATTTAGAATTAAAAAAATTATTCATTTATT
TTTTTACAACACTTATGCATAATTTAATTAAATGAGGTTTTTTTATAGAAAACATATCAT
TAAATTAATTGATTTTTTTTCAAAATAAATATCTTTTATAGTTTTTACTATTTATAAATT
ATTTTATGTAATTTAATTAAAAAATAAATAAAAAATAGGACATGTACCAACAATAGTATA
ATCCAGTATACAACTAACAAAAGGCAGATGTTTTCAGTATTGGTATGTGTATGCTTCATG
CAGCTCTTCTTTAACCTTTGGATGACTTATATGATTATAAAACTTTCTAAATCAACGAAG
CTTTACTCCACGAAAGATTAAATCAAGTAAGAGAAAATTACGGAGATCTTCTCTACTAAT
ACTTGTACCATATGCTCAATTTTAATGCTGATGATCGTTAAGATATTGCTTATTTTTACT
AGTAAATTAATCTCTAGTAGGAATATGCAGAAACAGCTACTTTCTAATAAGCTGAAAATA
CTTCTGCTTAAATTCAAAAGCAGGTTGAATACACTACTACTTAAACTAGTGTAACTAAAT
CACCTGAAAGAGCCTACTAACCTTATGAAGTTATTACTACTAAAACTATCAAGACTACAA
CAGTTCCAAAAGTAATTAATTATTAATTTAAAATAAACAAGTTTTCAGATATAATATTGA
GAATTTTAAATTTATTTTTTTACAGATAAAATTGAGTTTAAACAGTTTTAATATATTAAG
TATATTATATAATGTTGTCCTTTTAATTAAAATAACCCTTGACAATTTTTTTATTTTCAA
AAAATTTTATTCGGGCTTTCCCAAGAAATTATTAATTTTAACAGTAGGAGGAAGAAGTAG
TGAAGAGATCAGCTGCTAATCCAAATTATGGTTAAGTTTAAGTTTAAATTCAACAATAGC
CTTAGATAGTTATCTAAAAAATGTCTAATCAACCTACTGGTTATAGCTCTGCAGGCATGT
TCAAAGATTCTGAAGATAAAGGTAGTACAATCACCTTTATTCCAAAGGATCAAAACTCTA
AGAATGCTATTCCAGATGAAAATATTGGAAATGCTATTGGAGGAGGAGACACTTATTATC
AATAGTAATAGCAAAGTGTTGACATTTAGCCTTAAATTGTTACAACATCTAATAATTATG
TTCTTCCATAAACCAACACATATGTTACTTAAACATACACTAGTCCTCCCTTAAATTAAG
ACTACACAGCCAAATATACCTCTCCAGTTACAACTACTACTGTTACATACACTAACCCAA
CTGTCAATATTGCACCTTACACTCCACTTACTTAGTATTCTAGTTCAGTTGCTCCAGCAA
CTTCGACATCAAAGTATTCATCTACTTTCTAGCCAACTAACACTTATGAACTCTAAAAAG
GTTCAGAAGTATCCAATACAAATACTGGAGCTGGTTATTATGTTTCTACTAAAGAATAGT
TATATCAACCAGTTGCATAAACTACTAGCACAAATACCTAATTTACATCCGATTTGAGTA
AGCCTTACTAGACTACTTCTTATGGATTAAAAGAAAATAATTTTTCCTATATTCCAGGTC
CTAGTGCTAACACATATGGAAGTACTATTGGATTAAATTCTACTACAACTAATGTAGCAG
TATAGAATGCATCACCTGCATTAACAACTCCTGCTTTAACTACAGTAAATTAAACTTCAA
CATCTAACACTCAACCTGTAGTCACCAAATAATCTATTGTAAATACTACCGTTCCTGCTG
GTTCAACTTCTTCATACACAGCTACTAATACTTATGTTTCCCCAGCTCTCTCTCATATTC
TTAAAAAGGACGAATCAATTGAAGAAGCTATTAAGCGTTCAGCTCCTCCACCTCTCAAGA
GCGAATTAATTTCTTCTCCATATTCAGCATAAGTTGCATAGAATAGTGGATCCAATTTCT
ATACTCCAAGTATCACTACTACTTTGACTTAGCCTCCTATCTAAACCAACATTGCTACAG
GAACAACTACAACTACCACAACTACTACAGTTAAAAACAGTAATCCTGTAACAACAATCA
CTACTTCAAATACTGGCTACGATGCATATAAGCGTAATTTTAAAATACTTATTAAAATAT
TTCTTTCCCTCCTTTAATTTTCCAAAAAATTTGATTTTGAAAAAAAAATTGAGATTACCT
AAAAATAAAAAAAGAGAAACCCTCCCTCCTTATTACTTTAACATAATTAATTTCAAATAT
TAATTAAAAATAAATTAGTTGGTTGATTACTAATCAATGAACGAACGAACGAAATAATTA
TATATAGTTATGATATTTTAACTCAATTTATTTATTTAATATTTGCTTTAATATTAAATT
AGCTTCAGATGAAATAGAAGCCATTCTTGCTAAGTATAGAAACTAAAAGGAAACCATGTC
TTAACTTGGTTTAAGTTCTAACACTGCTGACATTAAAATTTCTAACAACTCTGTAGATGC
ACCATAAAATAACACAAATTTAGCAGGTGTTAATACCTATACAACAACTACTACAACAAC
TATTGCTAATAATACAGTCACTCCTTCCTATCAAGCTTACACTCCATCATAAACCTATAC
AGCTAACTTATCTAATATTGGTGGTAATTATGATATCAGTAAACCTATCGAGAGTTTAAA
TAATCAATTTTAAGGTCTTAACATTAACTAAAACCCAAATATTCAAGTATCCTAAGTTTA
AAGCTAATACACTGCCCAATTCAATCCTTCTTAGGTTTCAAATACCTACTAAACATCAAC
AGTAGGTACATCTAACTTAGGAGCAACAAATAGTAGTCCTTACACTTAAACATAGTAAAT
ATATTGAAAAAAATAATAAAAATTTAACACTTATTTAAAAAATTAGTAATATATAATAAT
CATTTGGATAATCTCAGCCTTAATCTTATTAATAGGAAACCTAATTAGTTAACGAGTACT
AAACAGAAGGTAAATATTTATTGACTTTTTCTTTTAAATGTTAAACTTATTTAATGAATT
TTTTAAATATTAGAAAAGGAGTATGTTATTGAAAATTATTCTAACAATTCTAAGTATGAA
GGAGAAAAACTCAATGGAATGAGACATGGTAGAGGTAAGTTCTACTATTAAGATGGTGGT
CTTTTCGATGGTGAATGGAGAGAAAATAAGATGCATGGCAAGGGTATTTTAAGCTATGCA
AGTGGTAAACCAGCTTATGATGGTGACTGGGTAGATGATAAATTCGAAGGTTTTGGAATT
CTTTACAATGAAAATCCTGCTCCCTTAAACTAACCCTATGATTTTAGCGATTTTGACAAT
GTTGAAGAATATTGGACAAAGTACGAAGGTTAATTTAAGGATGATAACAAAGAAGGATAT
GGTACTTTATTCCTCTCTAATGGTGAAAAGTTTGTTGGAACATTCTATAAAGATTTTGTT
AATGGTGCAGGAACTTTCTATACCTTAAATGGAGATGTCTTACAAGGACAATGGCACCAA
AATAAGTTTATTGCCTGA