Identifiers and Description

Gene Model Identifier

TTHERM_00691730

Standard Name

MRNO18 (Membrane Occupation and Recognition Nexus protein other)

Aliases

PreTt03011 | 106.m00151 | 3674.m00064

Description

Protein with predicted MORN domains localized throughout the protein and/or associated with other domains having a predicted function. Sequence similarity to a protein kinase family unique to Tetrahymena thermophila (Eisen et al., 2006)."

Genome Browser (Macronucleus)

GBrowse

Genome Browser (Micronucleus)

GBrowse

Gene Ontology Annotations

Molecular Function

Biological Process

Domains

Gene Expression Profile

  • Tetrahymena Functional Genomics Database:

TetraMine Data

TTHERM_00691730

WebApollo

Fullscreen View

Tetrahymena Stock Center

No Data fetched for StockID

Homologs (v.2006 protein sequences)

SourceIdentifierScoreDescription
Tetrahymena borealisEI9_17570.19.997093137033517e-262hypothetical protein (947 aa)
OxytrichaContig19607.0.1.g619.997019043202629e-21MORN repeat
WormBaseWBGene000031441locus:max-2 status:Partially
_confirmed UniProt:G5EGQ3
protein_id:CAQ35064.1

General Information

No Data fetched for General Information

Associated Literature

No Data fetched for Associated Literature

Sequences

>TTHERM_00691730(coding)
ATGGGAAAATCTTTAAGTAAAGACAGAAATTATGAAGAGTATCTCCTTCTGTATAGGAAA
ATAGAAAGCGTTAAAGACATTCATTATGGAGATATCGATATAATGGAATCGAAAGATAAA
AAATAGATTATAGCTATGAAAGATAGAAAATTTTAAAACCTTGAGAAATTGAGGGAATAG
TTAGGGCAAATTAGAAAGAGAAGAGACAACACTCATCCTAATTTTATATAGGTTTTAGAG
TATTTTGTGATGAGTGAAGATAATTTTTGTACTTCTATTTCTAGATTGATATGGACAATG
GAGTATATTAAAAAAGACCTTACAGTAGAAATACGTTAGCGTAAGTTGCAACAAATTCCT
TTCGATGTTAGTGAAATCTAATAAATTGCATTTGCTAGCATTTCAGCTTTCGCTAATTTG
TAAAGAGATGGTATTTACTTTAATGATTTGCGAGCTTAAAACATCCTCTTAACAAATAGT
TTAGAGGTTAAAATCTTAGATCCTGTATTTGAACCTAATCCTCCTCTTCTTATTTAAGTA
TTGCAAACTTCCAAGCCTAAAAAGGGCACTTACTTAGCACCAAATTATTTAAAATTTGCA
AAACAAAAGAATATTCCACACAAATTAACAACTCACAAATCAGAATCATTTTCTTTAGGT
TTCGTGTTAATGGAAGCGTGCTTATTGAATGAACAAGATGAATGCTTTGATTTTAGAGAA
GGAACAATTAATCTTGAAAATTATAAAAAGAATATCCAGTAAATTGAAGATACATATGGA
GAAGAAATTAGTTCTATGATAAAAGAAATGACCAATTTTAATGAAAAGCAAAGACTTGAT
TTTATTTAGTTAGAAACAAAGTATAATTTAAACACTAAGTTAGACAAGCCAATGTAATCA
AGTTAATTTTTACAAGGCTATAGCTCGACAAGTAAATTTCCAACTTCTTAATCGTAGTTG
AAGATAAATGGAGATCAGTCAATCAGCCAAATTTCTCATTTAGATTAAAACAAAAAGTCT
GCTTCACAAAAACAAATTAGACCATTGAGATAATTTGATCTGTTAAACAAAAATTCATCA
AAAGAAACAGTTAATACTGATCGCTCGCAAAATACAAAAGAAAAAAACTATTTTTGCAAG
ATTAACTATCAAACATTTTAGCTTTAAAAAATTGGGAGCCTAAACGTTGATCATAAAAAC
TTACCTACTAACAACTCATTTGTTTCAAATGCAGAAAGCTTTATTCCTTTCATCTAGAAT
TTAGATAGCCATTAAAATTTAAGAGATAAATAAACACCTCTGAATAAGAATAAATTTTAA
TAACAGAATAATATTAGTGAAAATAAATAAAATAAATAATAAAATAATTTAAGATCTGAC
TAAGCAATAACTCCAAGACACTCGATTAGCTTTGTGCATCAAGAAAATTTTGAAAACTAT
AATTAAAATACACTTAATGTAAATAAGCAAGATGGATTAAAGGAAAATGATAAAAATGTG
AATGAATTCAAAAAAAATACTAAACTTTAAGGCTAATTATAAAATTTTTATTCAAACATG
AGGAGCTAAAACGATAAAAGTATATTAAATAACACTTAAAAGCTTAATGCAAAGAATAAA
TCAATATCCTAAATGCAAAATAGCCTATTATAGAGCATGAGAATAGATTAAGCAGGTGAA
GACAAAGAAAATTTTAATTCTTCTAATGCTGAAATATTAAAGTGTTTAAAAGATGAAAGT
AATATAGAAAATACTTAAGATGCCTAAGCTTAGAACTAAAATACTTCTCACGAAAGTGTA
TATTTAACTGAAAATAATTTAAATAATCAAAATCAGTAAAATACACCAATATAGCAAACT
ACTAATGATAATACACCAAAAAGACAAATATAAAGTAACATTAAAAACAAATCTTATGAT
TCACCTTACAATTTATTTGGAAATAATTTAAATCCTATTGATGAAGACAAAAATGAAAAA
TACCAAAAAAGTAGCCCATAACTCTAAATATCTGTTACTGCAGATGGTGATATGATAAGT
GCTATTGATCCATAAAGCACTACAACAAAATAATAAAATAACTAGAATTAAACTAACAAT
TTAAATTCTCTTAACAAAAAATTCTTTAACATCAGTGAAATTAAATTTGAGGGAAATGGA
AATTAAAACTCAAATACAACAAATTTCATCAACACAAAATCCTCAGTAGTTCCATACCAA
ACAAACAATTAGCAATAGTCATTCTATAATAATAGTCACTATCAAACTTCCTTTATTGAA
GCATAGTCTATTTATATTTAATAGAGATCAAATTCATAAGTAATTGAAGTCATAGAAGAA
ACATATGAAGATGGATCAGTGTATAGTGGGGAGAAATTTAAAGGAAAGAGGCATGGTAAT
GGAAAATTCTTGTATGCAGATGGAGGTCTATATGAAGGATCATGGTTTGATGGATGCATG
GAAGGGTATGGAAAACTATATTATCCCTCCGGAAAATTAGCCTATGAAGGAGAATGGAAA
AGAGACAAATTTACAGGTTAAGGAGTTGTTTACAATGATACACCTGAAGAATTAGGTGAA
AATCAATCTTTTGACTTTACAGACTTTGACAAAATGGGTGAACATTGGATTTAATATGAA
GGAGGATTTCTTGATGACTAAAAGCAAGGATAAGGTATTTTATACTTGTCAAACGGAAAC
AGATTTATTGGAGGTTTCTTAAATGATATGGTAGAAGGTATAGGTATCTTTGTAAATTAA
GAGGGCAAGGAAATCAAAGCTCATTATTCTCAAAACAAACTATTAAAATTACTCTGA


>TTHERM_00691730(protein)
MGKSLSKDRNYEEYLLLYRKIESVKDIHYGDIDIMESKDKKQIIAMKDRKFQNLEKLREQ
LGQIRKRRDNTHPNFIQVLEYFVMSEDNFCTSISRLIWTMEYIKKDLTVEIRQRKLQQIP
FDVSEIQQIAFASISAFANLQRDGIYFNDLRAQNILLTNSLEVKILDPVFEPNPPLLIQV
LQTSKPKKGTYLAPNYLKFAKQKNIPHKLTTHKSESFSLGFVLMEACLLNEQDECFDFRE
GTINLENYKKNIQQIEDTYGEEISSMIKEMTNFNEKQRLDFIQLETKYNLNTKLDKPMQS
SQFLQGYSSTSKFPTSQSQLKINGDQSISQISHLDQNKKSASQKQIRPLRQFDLLNKNSS
KETVNTDRSQNTKEKNYFCKINYQTFQLQKIGSLNVDHKNLPTNNSFVSNAESFIPFIQN
LDSHQNLRDKQTPLNKNKFQQQNNISENKQNKQQNNLRSDQAITPRHSISFVHQENFENY
NQNTLNVNKQDGLKENDKNVNEFKKNTKLQGQLQNFYSNMRSQNDKSILNNTQKLNAKNK
SISQMQNSLLQSMRIDQAGEDKENFNSSNAEILKCLKDESNIENTQDAQAQNQNTSHESV
YLTENNLNNQNQQNTPIQQTTNDNTPKRQIQSNIKNKSYDSPYNLFGNNLNPIDEDKNEK
YQKSSPQLQISVTADGDMISAIDPQSTTTKQQNNQNQTNNLNSLNKKFFNISEIKFEGNG
NQNSNTTNFINTKSSVVPYQTNNQQQSFYNNSHYQTSFIEAQSIYIQQRSNSQVIEVIEE
TYEDGSVYSGEKFKGKRHGNGKFLYADGGLYEGSWFDGCMEGYGKLYYPSGKLAYEGEWK
RDKFTGQGVVYNDTPEELGENQSFDFTDFDKMGEHWIQYEGGFLDDQKQGQGILYLSNGN
RFIGGFLNDMVEGIGIFVNQEGKEIKAHYSQNKLLKLL


>TTHERM_00691730(gene)
ATGGGAAAATCTTTAAGTAAAGACAGAAATTATGAAGAGTATCTCCTTCTGTATAGGAAA
ATAGAAAGCGTTAAAGACATTCATTATGGAGATATCGATATAATGGAATCGAAAGATAAA
AAATAGATTATAGCTATGAAAGATAGAAAATTTTAAAACCTTGAGAAATTGAGGGAATAG
TTAGGGCAAATTAGAAAGAGAAGAGACAACACTCATCCTAATTTTATATAGGTTTTAGAG
TATTTTGTGATGAGTGAAGATAATTTTTGTACTTCTATTTCTAGATTGATATGGACAATG
GAGTATATTAAAAAAGACCTTACAGTAGAAATACGTTAGCGTAAGTTGCAACAAATTCCT
TTCGATGTTAGTGAAATCTAATAAATTGCATTTGCTAGCATTTCAGCTTTCGCTAATTTG
TAAAGAGATGGTATTTACTTTAATGATTTGCGAGCTTAAAACATCCTCTTAACAAATAGT
TTAGAGGTTAAAATCTTAGATCCTGTATTTGAACCTAATCCTCCTCTTCTTATTTAAGTA
TTGCAAACTTCCAAGCCTAAAAAGGGCACTTACTTAGCACCAAATTATTTAAAATTTGCA
AAACAAAAGAATATTCCACACAAATTAACAACTCACAAATCAGAATCATTTTCTTTAGGT
AAATTTTGATTCTTTATAATACATGACTGACTGATAATTAATTATTTAAAAACACTCCTT
ATCACTATACTATATTTATCTTTTTGAATGACACTAAATTTATAAATTTATTGTTAAATT
AACTAAATAATTATAAGGTTTCGTGTTAATGGAAGCGTGCTTATTGAATGAACAAGATGA
ATGCTTTGATTTTAGAGAAGGAACAATTAATCTTGAAAATTATAAAAAGAATATCCAGTA
AATTGAAGATACATATGGAGAAGAAATTAGTTCTATGATAAAAGAAATGACCAATTTTAA
TGAAAAGCAAAGACTTGATTTTATTTAGTTAGAAACAAAGTATAATTTAAACACTAAGTT
AGACAAGCCAATGTAATCAAGTTAATTTTTACAAGGCTATAGCTCGACAAGTAAATTTCC
AACTTCTTAATCGTAGTTGAAGATAAATGGAGATCAGTCAATCAGCCAAATTTCTCATTT
AGATTAAAACAAAAAGTCTGCTTCACAAAAACAAATTAGACCATTGAGATAATTTGATCT
GTTAAACAAAAGTATTTCTTTCTTAATTAAAAAAGAGTGTTTTTTTTAATATTTTTATTT
TTAGAGGATTTTATTAAATTTTTTCAATCTTTTTTTTTGGTTGACGAAATATTACTGATT
AATTTTAAATTTTAAATTAATTAGATTCATCAAAAGAAACAGTTAATACTGATCGCTCGC
AAAATACAAAAGAAAAAAACTATTTTTGCAAGATTAACTATCAAACATTTTAGCTTTAAA
AAATTGGGAGCCTAAACGTTGATCATAAAAACTTACCTACTAACAACTCATTTGTTTCAA
ATGCAGAAAGCTTTATTCCTTTCATCTAGAATTTAGATAGCCATTAAAATTTAAGAGATA
AATAAACACCTCTGAATAAGAATAAATTTTAATAACAGAATAATATTAGTGAAAATAAAT
AAAATAAATAATAAAATAATTTAAGATCTGACTAAGCAATAACTCCAAGACACTCGATTA
GCTTTGTGCATCAAGAAAATTTTGAAAACTATAATTAAAATACACTTAATGTAAATAAGC
AAGATGGATTAAAGGAAAATGATAAAAATGTGAATGAATTCAAAAAAAATACTAAACTTT
AAGGCTAATTATAAAATTTTTATTCAAACATGAGGAGCTAAAACGATAAAAGTATATTAA
ATAACACTTAAAAGCTTAATGCAAAGAATAAATCAATATCCTAAATGCAAAATAGCCTAT
TATAGAGCATGAGAATAGATTAAGCAGGTGAAGACAAAGAAAATTTTAATTCTTCTAATG
CTGAAATATTAAAGTGTTTAAAAGATGAAAGTAATATAGAAAATACTTAAGATGCCTAAG
CTTAGAACTAAAATACTTCTCACGAAAGTGTATATTTAACTGAAAATAATTTAAATAATC
AAAATCAGTAAAATACACCAATATAGCAAACTACTAATGATAATACACCAAAAAGACAAA
TATAAAGTAACATTAAAAACAAATCTTATGATTCACCTTACAATTTATTTGGAAATAATT
TAAATCCTATTGATGAAGACAAAAATGAAAAATACCAAAAAAGTAGCCCATAACTCTAAA
TATCTGTTACTGCAGATGGTGATATGATAAGTGCTATTGATCCATAAAGCACTACAACAA
AATAATAAAATAACTAGAATTAAACTAACAATTTAAATTCTCTTAACAAAAAATTCTTTA
ACATCAGTGAAATTAAATTTGAGGGAAATGGAAATTAAAACTCAAATACAACAAATTTCA
TCAACACAAAATCCTCAGTAGTTCCATACCAAACAAACAATTAGCAATAGTCATTCTATA
ATAATAGTCACTATCAAACTTCCTTTATTGAAGCATAGTCTATTTATATTTAATAGAGAT
CAAATTCATAAGTAATTGAAGGTAATTTATAAATATTTACAATAATTATATATTTTTTAT
ATCATTTAATCTTTGTTATATATAGTCATAGAAGAAACATATGAAGATGGATCAGTGTAT
AGTGGGGAGAAATTTAAAGGAAAGAGGCATGGTAATGGAAAATTCTTGTATGCAGATGGA
GGTCTATATGAAGGATCATGGTTTGATGGATGCATGGAAGGGTATGGAAAACTATATTAT
CCCTCCGGAAAATTAGCCTATGAAGGAGAATGGAAAAGAGACAAATTTACAGGTTAAGGA
GTTGTTTACAATGATACACCTGAAGAATTAGGTGAAAATCAATCTTTTGACTTTACAGAC
TTTGACAAAATGGGTGAACATTGGATTTAATATGAAGGAGGATTTCTTGATGACTAAAAG
CAAGGATAAGGTATTTTATACTTGTCAAACGGAAACAGATTTATTGGAGGTTTCTTAAAT
GATATGGTAGAAGGTATAGGTATCTTTGTAAATTAAGAGGGCAAGGAAATCAAAGCTCAT
TATTCTCAAAACAAACTATTAAAATTACTCTGA