Identifiers and Description

Gene Model Identifier

TTHERM_00426040

Standard Name

MRNO17 (Membrane Occupation and Recognition Nexus protein other)

Aliases

PreTt14039 | 47.m00234

Description

Protein with predicted MORN domains localized throughout the protein and/or associated with other domains having a predicted function Protein kinase domain containing protein.

Genome Browser (Macronucleus)

GBrowse

Genome Browser (Micronucleus)

GBrowse

Gene Ontology Annotations

Molecular Function

Biological Process

Domains

Gene Expression Profile

  • Tetrahymena Functional Genomics Database:

Change in Gene Expression

TMHMM

TMHMM

Signal Peptide

Signal Peptide Present?: No
Presense Probability: 10.2%

TetraMine Data

TTHERM_00426040

WebApollo

Fullscreen View

Tetrahymena Stock Center

No Data fetched for StockID

Homologs (v.2006 protein sequences)

SourceIdentifierScoreDescription
Tetrahymena borealisEI9_07778.12.0007467515522948e-59hypothetical protein (457 aa)
DictyBaseDDB_G02691523.9992896861436003e-19mekA on chromosome: 1 position
4015409 to 4017699
OxytrichaContig10261.0.g88.99902975825788e-19Protein kinase domain
SGDYOR231W1.999598840915195e-17MKK1 Mitogen-activated kinase
kinase involved in protein kin
ase C signaling pathway that c
ontrols cell integrity; upon a
ctivation by Bck1p phosphoryla
tes downstream target, Slt2p;
functionally redundant with Mk
k2p
WormBaseWBGene000015262.9992476920535046e-16locus:gck-1 status:Partially
_confirmed UniProt:H2L0A1
protein_id:CCD72152.2
Stentor CoeruleusSteCoe_153460.00000001522997974471263

General Information

No Data fetched for General Information

Associated Literature

No Data fetched for Associated Literature

Sequences

>TTHERM_00426040(coding)
ATGAATATTTAAGAGATATCATAAGAACAAATAAATGATTATTTAACGTTAAAAAAAATA
GATATTTCAAATGAAAGAATAAAAAAAGGCATATAATATTTAAAATAATTTGATATTTTT
ATATCTAAAATCTTAGGAAATGGCTAATTTGGGATTGTTTTTTAAGGATATGATTAGCAA
AACAAAAGAAAGATTGCTATTAAGTTAATTTTTGGGTAAAATGAGTAATTTGTAAATGAA
TATATCAATGAAGCTCAACTGGCGAGACAAATTAATAGCAAGTTTGTAGTAAAAATGCAT
GACTAATTCTATGATTAAGAAAATAAAAACTACTTTATCATTTACGAATATTGTGAAGTA
GGAAATCTCTAAAATTACTACAAAGAGTTGAATTAATAGCAAATTCTAGATATAGCTATT
TATTTAACTCAAGGAATTTTAGATATTCATGCCAAATAAATCATTCATAGTGATATTAAA
CCAGAAAACATTTTATTATCTACAGAAAATGGCTAGTTGATTGCTAAAATTGGGGATTTA
GGACTTTCTAAAAAGTTGTAAAAAAATCTAACTCACATCTCTACATACTAAGGTACTTAT
TCTTTTATGGCTTATGAGTAAACTGAAGGAAAACTATGTATGGAGTCAGATTATTTCGCA
CTTGGTTCAGTTATTTGCTTTATTTCAGGAATAAATTTGCTAGATTTTATGACAATGTCA
TTGTTAAAAACTGGATATTATAAAGATAACTAAGAAAACCCTTTGATATCTTTAGCCTTA
GAATTGACGAAAAAAGAACCTTAAGAGAGAATGAAATTAAATACATTTTTATCTAAATTA
GAAAGCATGAGAAAAGATTAGCAGTAATAATAGAATAATAAAAATTCAAAAGGCAATAAT
TTTAAATCTATTAAAGCAAATATTTTTAAATTTTCTATCATAGTTCTACTTACGTTAATC
ATTATAAAAGTTGGAATCTAAATTAAATAAAATTCAACAAACAATCAAAACTACAAAAAA
ATTCTTTATCAAAATGGATCGTTCTATGAAGGCTATATAAAAAATGATGAAAAACATGGA
ATAGGTAAACTTGATTTTAATGATGGAACAATTTATGTAGGTGAATTTAAAAATGACTAA
TTTAACGGCTTTGGAAATCTCACATACAAGGAGGGTCATGTTTATGTAGGGCAGTTCAAG
GATAATTTATTTAATGGAAAAGGTTTTATTAAATATAATAATTATACAAGTTATGATGGG
GAGTTTAAGAATGGAAAATATAACGGGTATGGAGAATTTAAATAGAATAATGGAACTATG
TTAAAAGGTAAATGGAAAGAAGGAATATTCATCTAATGA


>TTHERM_00426040(protein)
MNIQEISQEQINDYLTLKKIDISNERIKKGIQYLKQFDIFISKILGNGQFGIVFQGYDQQ
NKRKIAIKLIFGQNEQFVNEYINEAQLARQINSKFVVKMHDQFYDQENKNYFIIYEYCEV
GNLQNYYKELNQQQILDIAIYLTQGILDIHAKQIIHSDIKPENILLSTENGQLIAKIGDL
GLSKKLQKNLTHISTYQGTYSFMAYEQTEGKLCMESDYFALGSVICFISGINLLDFMTMS
LLKTGYYKDNQENPLISLALELTKKEPQERMKLNTFLSKLESMRKDQQQQQNNKNSKGNN
FKSIKANIFKFSIIVLLTLIIIKVGIQIKQNSTNNQNYKKILYQNGSFYEGYIKNDEKHG
IGKLDFNDGTIYVGEFKNDQFNGFGNLTYKEGHVYVGQFKDNLFNGKGFIKYNNYTSYDG
EFKNGKYNGYGEFKQNNGTMLKGKWKEGIFIQ


>TTHERM_00426040(gene)
ATGAATATTTAAGAGATATCATAAGAACAAATAAATGATTATTTAACGTTAAAAAAAATA
GATATTTCAAATGAAAGAATAAAAAAAGGCATATAATATTTAAAATAATTTGATATTTTT
ATATCTAAAATCTTAGGAAATGGCTAATTTGGGATTGTTTTTTAAGGATATGATTAGCAA
AACAAAAGAAAGATTGCTATTAAGTTAATTTTTGGGTAAAATGAGTAATTTGTAAATGAA
TATATCAATGAAGCTCAACTGGCGAGACAAATTAATAGCAAGTTTGTAGTAAAAATGCAT
GACTAATTCTATGATTAAGAAAATAAAAACTACTTTATCATTTACGAATATTGTGAAGTA
GGAAATCTCTAAAATTACTACAAAGAGTTGAATTAATAGCAAATTCTAGATATAGCTATT
TATTTAACTCAAGGAATTTTAGATATTCATGCCAAATAAATCATTCATAGTGATATTAAA
CCAGAAAACATTTTATTATCTACAGAAAATGGCTAGTTGATTGCTAAAATTGGGGATTTA
GGACTTTCTAAAAAGTTGTAAAAAAATCTAACTCACATCTCTACATACTAAGGTACTTAT
TCTTTTATGGCTTATGAGTAAACTGAAGGAAAACTATGTATGGAGTCAGATTATTTCGCA
CTTGGTTCAGTTATTTGCTTTATTTCAGGAATAAATTTGCTAGATTTTATGACAATGTCA
TTGTTAAAAACTGGATATTATAAAGATAACTAAGAAAACCCTTTGATATCTTTAGCCTTA
GAATTGACGAAAAAAGAACCTTAAGAGAGAATGAAATTAAATACATTTTTATCTAAATTA
GAAAGCATGAGAAAAGATTAGCAGTAATAATAGAATAATAAAAATTCAAAAGGCAATAAT
TTTAAATCTATTAAAGCAAATATTTTTAAATTTTCTATCATAGTTCTACTTACGTTAATC
ATTATAAAAGTTGGAATCTAAATTAAATAAAATTCAACAAACAATCAAAACTACAAAAAA
ATTCTTTATCAAAATGGATCGTTCTATGAAGGCTATATAAAAAATGATGAAAAACATGGA
ATAGGTAAACTTGATTTTAATGATGGAACAATTTATGTAGGTGAATTTAAAAATGACTAA
TTTAACGGCTTTGGAAATCTCACATACAAGGAGGGTCATGTTTATGTAGGGCAGTTCAAG
GATAATTTATTTAATGGAAAAGGTTTTATTAAATATAATAATTATACAAGTTATGATGGG
GAGTTTAAGAATGGAAAATATAACGGGTATGGAGAATTTAAATAGAATAATGGAACTATG
TTAAAAGGTAAATGGAAAGAAGGAATATTCATCTAATGA