Identifiers and Description

Gene Model Identifier

TTHERM_00522110

Standard Name

MRNO15 (Membrane Occupation and Recognition Nexus protein other)

Aliases

PreTt12326 | 65.m00144 | 3717.m00023

Description

Protein with predicted MORN domains localized throughout the protein and/or associated with other domains having a predicted function

Genome Browser (Macronucleus)

GBrowse

Genome Browser (Micronucleus)

GBrowse

Gene Ontology Annotations

No Data fetched for Gene Ontology Annotations

Domains

Gene Expression Profile

  • Tetrahymena Functional Genomics Database:

Change in Gene Expression

TMHMM

TMHMM

Signal Peptide

Signal Peptide Present?: No
Presense Probability: 10.6%

TetraMine Data

TTHERM_00522110

WebApollo

Fullscreen View

Tetrahymena Stock Center

No Data fetched for StockID

Homologs (v.2006 protein sequences)

SourceIdentifierScoreDescription
Tetrahymena borealisEI9_12897.15.001736064328732e-162hypothetical protein (390 aa)
OxytrichaContig13677.0.1.g358.997498379799854e-17MORN repeat
DictyBaseDDB_G03494880.0000000039998859049333245DDB_G0349488 on chromosome: 2
position 6912714 to 6914186
WormBaseWBGene000021790.0007999190683310628locus:jph-1 status:Confirmed
UniProt:Q22667 protein_id
:CAA99924.2

General Information

No Data fetched for General Information

Associated Literature

No Data fetched for Associated Literature

Sequences

>TTHERM_00522110(coding)
ATGATAGATTTAAGTTTAAGCTAAGTTGATTTTGAGGATTAGAAATTAAGCAACTTAATT
TGTTAGTATCATAAAAGAAAGGTTACCGCATTTTGTATCCAACAAGATTGCCATTAAAAT
GATAGATTTGCATGTTTTTAATGCTTATCTAGCAGGGAGCATTCTAATCATTAGTTCATT
GACTCTGAAGATGTCGTTTCTATTTTGAAGCAAGGTCTCCCAAGTTTTAAAAATTAAATT
ATATAAAACTTTGAACAACTCAGCAAGAGCATTGTATCTTTGTTTTAAAACAAAGTAAAG
AATTTTATTAATTAAAAAGCAGATACATTTGCATAGCGTTTTGAGCGTTGCTTCTCATTA
AATATTTCTGAAAGAGATTAGAAACTCTCTGAATAATTGCTTGAGTTATACAAATTAATA
TACAAGTAAAATGGGAATTATTTATTAGATATTTGCTAAAGCATGGGTTAAACTCTATAT
TCCTCTATATAAAAATAACTTGAAACAATAATGAAAAAAATAAATGATTATGAATTTGAT
AAAGAACTTTAAAGATTTGAAATAGAAAACTAGGTAATTCATAATCTTACTAAAGAAGCA
TTAGAAGCTTATTAGAAATACAAAAATGAAAATATTTTTGATGATCTAAATAAAGAAAAT
AATAATGACTCAAGGCTTTATTTGGTAAACGATAGAGACTTTTATACTGTATCTTAATTT
AACATAGAAGGATAAAGGCATGGTAGAACAATTGAAATTCCTTCTTAAGGCCATTATTTT
AAAGGTTATTTAAGCAATGGTTTAAGAAACGGAAAAGGGCTCTATATTTATTAGGATGGT
ACAGTATATTTAGGGATTTTTAAAAATAATTAAAAAGATGGTAGTGGTAAGTTAATAAAT
CGAGATGGCTACATTTATAGCGGAGAATGGAAGGAAGATTAAAAGAATGGGGTAGGAGAA
GAAAAATTTAACGATGACTGGGTTTTTGAAGGGTTCTTTGAAAATAATTAAAGAAATGGG
CCAGGTTAAGAAACAAATAAAAAATTAGGTTTAGTTATTCAAGCAATATATGAGAAAGGC
GAGATAGTTAACACTATTTCATAATTATAAATATAATAATAGTTATAACAACCATAGTGA


>TTHERM_00522110(protein)
MIDLSLSQVDFEDQKLSNLICQYHKRKVTAFCIQQDCHQNDRFACFQCLSSREHSNHQFI
DSEDVVSILKQGLPSFKNQIIQNFEQLSKSIVSLFQNKVKNFINQKADTFAQRFERCFSL
NISERDQKLSEQLLELYKLIYKQNGNYLLDICQSMGQTLYSSIQKQLETIMKKINDYEFD
KELQRFEIENQVIHNLTKEALEAYQKYKNENIFDDLNKENNNDSRLYLVNDRDFYTVSQF
NIEGQRHGRTIEIPSQGHYFKGYLSNGLRNGKGLYIYQDGTVYLGIFKNNQKDGSGKLIN
RDGYIYSGEWKEDQKNGVGEEKFNDDWVFEGFFENNQRNGPGQETNKKLGLVIQAIYEKG
EIVNTISQLQIQQQLQQPQ


>TTHERM_00522110(gene)
ATGATAGATTTAAGTTTAAGCTAAGTTGATTTTGAGGATTAGAAATTAAGCAACTTAATT
TGTTAGTATCATAAAAGAAAGGTTACCGCATTTTGTATCCAACAAGATTGCCATTAAAAT
GATAGATTTGCATGTTTTTAATGCTTATCTAGCAGGGAGCATTCTAATCATTAGTTCATT
GACTCTGAAGATGTCGTTTCTATTTTGAAGCAAGGTCTCCCAAGTTTTAAAAATTAAATT
ATATAAAACTTTGAACAACTCAGCAAGAGCATTGTATCTTTGTTTTAAAACAAAGTAAAG
AATTTTATTAATTAAAAAGCAGATACATTTGCATAGCGTTTTGAGCGTTGCTTCTCATTA
AATATTTCTGAAAGAGATTAGAAACTCTCTGAATAATTGCTTGAGTTATACAAATTAATA
TACAAGTAAAATGGGAATTATTTATTAGATATTTGCTAAAGCATGGGTTAAACTCTATAT
TCCTCTATATAAAAATAACTTGAAACAATAATGAAAAAAATAAATGATTATGAATTTGAT
AAAGAACTTTAAAGATTTGAAATAGAAAACTAGGTAATTCATAATCTTACTAAAGAAGCA
TTAGAAGCTTATTAGAAATACAAAAATGAAAATATTTTTGATGATCTAAATAAAGAAAAT
AATAATGACTCAAGGCTTTATTTGGTAAACGATAGAGACTTTTATACTGTATCTTAATTT
AACATAGAAGGATAAAGGCATGGTAGAACAATTGAAATTCCTTCTTAAGGCCATTATTTT
AAAGGTTATTTAAGCAATGGTTTAAGAAACGGAAAAGGGCTCTATATTTATTAGGATGGT
ACAGTATATTTAGGGATTTTTAAAAATAATTAAAAAGATGGTAGTGGTAAGTTAATAAAT
CGAGATGGCTACATTTATAGCGGAGAATGGAAGGAAGATTAAAAGAATGGGGTAGGAGAA
GAAAAATTTAACGATGACTGGGTTTTTGAAGGGTTCTTTGAAAATAATTAAAGAAATGGG
CCAGGTTAAGAAACAAATAAAAAATTAGGTTTAGTTATTCAAGCAATATATGAGAAAGGC
GAGATAGTTAACACTATTTCATAATTATAAATATAATAATAGTTATAACAACCATAGTGA