Identifiers and Description

Gene Model Identifier

TTHERM_00703340

Standard Name

MRNO14 (Membrane Occupation and Recognition Nexus protein other)

Aliases

PreTt20110 | 110.m00083

Description

Protein with predicted MORN domains localized throughout the protein and/or associated with other domains having a predicted function. Phosphatidylinositol-4-phosphate 5-kinase-related

Genome Browser (Macronucleus)

GBrowse

Genome Browser (Micronucleus)

GBrowse

Gene Ontology Annotations

No Data fetched for Gene Ontology Annotations

Domains

Gene Expression Profile

  • Tetrahymena Functional Genomics Database:

Change in Gene Expression

TMHMM

TMHMM

Signal Peptide

Signal Peptide Present?: No
Presense Probability: 10.2%

TetraMine Data

TTHERM_00703340

WebApollo

Fullscreen View

Tetrahymena Stock Center

No Data fetched for StockID

Homologs (v.2006 protein sequences)

SourceIdentifierScoreDescription
Tetrahymena borealisEI9_15320.11.000444791949842e-158phosphatidylinositol-4-phospha
te 5-kinase (271 aa)
OxytrichaContig22122.0.g350.000000000000001999258566166494MORN repeat
WormBaseWBGene000021790.00020003864201578029locus:jph-1 status:Confirmed
UniProt:Q22667 protein_id
:CAA99924.2

General Information

No Data fetched for General Information

Associated Literature

No Data fetched for Associated Literature

Sequences

>TTHERM_00703340(coding)
ATGGGAAACACAGAAACATTAAATAAGCCAATCAGACAAAGTAGTAGTGGTTCATCTTCT
CCAAACTTCTATAAACAGATAACTTCTAATGCCAGTTGGAATGATCTTGACAATAAAATA
GCTTCAGGACTAATTTTAGATGAAGTAAATGAAGACGACAAGATGGAAATAAACAAAAAA
AAATTGAATTTATCTCCTGAATTTGCTAATTTAGAGTACAAAGTGAAATTCTTTACTCAA
AGAGTTTCAAATTCTCCCTCAAACTCTAAATAATATGAAGTTACTTAGACTGGTAAAACG
AATAATAATAGGTATGAGGGAACATTTAAAGATGGTTAACTCTTCGGCTAAGGCATCTAT
TTTTATCCATCAGGCAGTATATATATGGGTGGAATAAAAGATAACGGAAGAGATGGTTAA
GGTGTCTTCTACTTTGCTAATGGAAATATCTACTCTGGCTAGTGGTAAAATAATGATTAA
TCAGGCTTAGGAAAATTCTTCTTTGTATAAAATGAAAAATTATTCTAATTTTATTATGGG
TATTTCAAAAACTCGCTTTATTAAGGATTTGGGTGCTACTGCTATCAATAAAAATATTAC
ATTGGTTTTTGGAAAGAAGATAAATACGAAGGCCATGGAAAAATATTTTCATTTGAGGGT
AAACTAGTTAGATGCGGAATCTTTAAACAAGATAAACTAATATAAGAGCTACCTGAAGAA
GAAATCTAATTCCCTCAAAATTGGTAGTCATTTTTACCTAATTTCAGCAGAGAGCTAAAC
TACTTTTAGGAATTAATAAGCAATAAGCCTCTCGTTTGA


>TTHERM_00703340(protein)
MGNTETLNKPIRQSSSGSSSPNFYKQITSNASWNDLDNKIASGLILDEVNEDDKMEINKK
KLNLSPEFANLEYKVKFFTQRVSNSPSNSKQYEVTQTGKTNNNRYEGTFKDGQLFGQGIY
FYPSGSIYMGGIKDNGRDGQGVFYFANGNIYSGQWQNNDQSGLGKFFFVQNEKLFQFYYG
YFKNSLYQGFGCYCYQQKYYIGFWKEDKYEGHGKIFSFEGKLVRCGIFKQDKLIQELPEE
EIQFPQNWQSFLPNFSRELNYFQELISNKPLV


>TTHERM_00703340(gene)
ATGGGAAACACAGAAACATTAAATAAGCCAATCAGACAAAGTAGTAGTGGTTCATCTTCT
CCAAACTTCTATAAACAGATAACTTCTAATGCCAGTTGGAATGATCTTGACAATAAAATA
GCTTCAGGACTAATTTTAGGTAAAATTTGTCATTATTATTATTAGTTCATTAAAAATTTT
AAGGCTATTATCAAAAATGACATCAAACTTCTACATTTATATTATTTATCATTTTAATAA
ACAGATGAAGTAAATGAAGACGACAAGATGGAAATAAACAAAAAAAAATTGAATTTATCT
CCTGAATTTGCTAATTTAGAGTACAAAGTGAAATTCTTTACTCAAAGAGTTTCAAATTCT
CCCTCAAACTCTAAATAATATGAAGTTACTTAGACTGGTAAAACGAATAATAATAGGTAT
GAGGGAACATTTAAAGATGGTTAACTCTTCGGCTAAGGCATCTATTTTTATCCATCAGGC
AGTATATATATGGGTGGAATAAAAGATAACGGAAGAGATGGTTAAGGTGTCTTCTACTTT
GCTAATGGAAATATCTACTCTGGCTAGTGGTAAAATAATGATTAATCAGGCTTAGGAAAA
TTCTTCTTTGTATAAAATGAAAAATTATTCTAATTTTATTATGGGTATTTCAAAAACTCG
CTTTATTAAGGATTTGGGTGCTACTGCTATCAATAAAAATATTACATTGGTTTTTGGAAA
GAAGATAAATACGAAGGCCATGGAAAAATATTTTCATTTGAGGGTAAACTAGTTAGATGC
GGAATCTTTAAACAAGATAAACTAATATAAGAGCTACCTGAAGAAGAAATCTAATTCCCT
CAAAATTGGTAGTCATTTTTACCTAATTTCAGCAGAGAGCTAAACTACTTTTAGGAATTA
ATAAGCAATAAGCCTCTCGTTTGA