Identifiers and Description

Gene Model Identifier

TTHERM_00584920

Standard Name

MRNO13 (Membrane Occupation and Recognition Nexus protein other)

Aliases

PreTt04099 | 80.m00145 | 3675.m00043

Description

Protein with predicted MORN domains localized throughout the protein and/or associated with other domains having a predicted function

Genome Browser (Macronucleus)

GBrowse

Genome Browser (Micronucleus)

GBrowse

Gene Ontology Annotations

No Data fetched for Gene Ontology Annotations

Domains

Gene Expression Profile

  • Tetrahymena Functional Genomics Database:

TetraMine Data

TTHERM_00584920

WebApollo

Fullscreen View

Tetrahymena Stock Center

No Data fetched for StockID

Homologs (v.2006 protein sequences)

SourceIdentifierScoreDescription
Tetrahymena borealisEI9_15220.11.999683289470905e-41hypothetical protein (258 aa)
OxytrichaContig21483.0.g100.00000000000001000191320216021MORN repeat
DictyBaseDDB_G02882270.0000020007268868677913DDB_G0288227 on chromosome: 5
position 1280700 to 1282179

General Information

No Data fetched for General Information

Associated Literature

No Data fetched for Associated Literature

Sequences

>TTHERM_00584920(coding)
ATGTATCTTATTTTAGAATTTAATTTATTAAATTTAGAAATAACATATAGCTTACAAACT
TATTATTAAAAAAAATTTTTCCTGCTTATATTAATATTTTTTGTTTTGTTTGACTCTATT
TCTTTTCTTCAAAATATTTAAAAAATTCTGTTAACCAGTATTTCTAAGAATATTTTAAAG
AAAGTCCGTACAGTTAATCCAGAACCATTTGTTTACCTCTAAAATTTTAATATATCAATA
AATAAATCATTTTAAAATAACTTATTAATTAATGAATCAAATTTTTAAAAAATATCGAAA
TTAAATTTGTTTTTTTAAATAAGAAGAAGATTCAATAATTAATATTCATAAATTAGATCT
ACGAAGTATTTAAAATTTAATTAAGTAAACTTAAAATTATTTGTTATCAAAAACATGCAA
GAAAACAAAAAATAATAATTATTTGCATAACAAATTACTATGTCAAGCAATAAAATTTAA
ACAAATTAAAATATTTAAGAAATTAAGTTATTATAAATAACGCAGAATAAATCTTAAGTT
TCAATAATTGGTTTTAAATGCGGAGGGATTTATTTAGGTTCTACAAAGGATAATAAAAGA
AATGGTGAAGGAAAGTAATTCTATTCTAATGGAAACTATTACGAAGGTGAATGGTCTTAA
GATCTTCAAGATGGTATTGGTCTTTTCAAATATAATACTGGTGATTTTTACTAAGGAGAA
TTTTTTTAGGGATAATTTTAAGGATTTGGAAAATATTTTTATGCTTAAAGTAAAAGATTG
TATATTGGATTTTGGTTAAATAGTAAATGGCATGGTTAAGGCTCATTTTATAGTGATCAA
GGAGATTTATTAATTGATGGAATTTGGGAATGTGATAATCTTATCTAAGAAAATATATAA
ATAAATAAAAATATTACTTGTAAAAATGAGCCAAATACACATAAAAAATAAATAAGTATT
TAATCTCTGATAAAAAAGAGTAATTAAATATAGTCAAAAGATAATCAGAATAGTTTTAGT
ATTTAAAATATAAAAAATATTAATGGATCAAAATACAAATCATTATTATCTAATATAAAA
AATTTATTATTTTAAAATAAACATTAAAAACTAAAATAGTGTTTAATTGAATAAAGTGTT
ATTATATGA


>TTHERM_00584920(protein)
MYLILEFNLLNLEITYSLQTYYQKKFFLLILIFFVLFDSISFLQNIQKILLTSISKNILK
KVRTVNPEPFVYLQNFNISINKSFQNNLLINESNFQKISKLNLFFQIRRRFNNQYSQIRS
TKYLKFNQVNLKLFVIKNMQENKKQQLFAQQITMSSNKIQTNQNIQEIKLLQITQNKSQV
SIIGFKCGGIYLGSTKDNKRNGEGKQFYSNGNYYEGEWSQDLQDGIGLFKYNTGDFYQGE
FFQGQFQGFGKYFYAQSKRLYIGFWLNSKWHGQGSFYSDQGDLLIDGIWECDNLIQENIQ
INKNITCKNEPNTHKKQISIQSLIKKSNQIQSKDNQNSFSIQNIKNINGSKYKSLLSNIK
NLLFQNKHQKLKQCLIEQSVII


>TTHERM_00584920(gene)
ATGTATCTTATTTTAGAATTTAATTTATTAAATTTAGAAATAACATATAGCTTACAAACT
TATTATTAAAAAAAATTTTTCCTGCTTATATTAATATTTTTTGTTTTGTTTGACTCTATT
TCTTTTCTTCAAAATATTTAAAAAATTCTGTTAACCAGTATTTCTAAGAATATTTTAAAG
AAAGTCCGTACAGTTAATCCAGAACCATTTGTTTACCTCTAAAATTTTAATATATCAATA
AATAAATCATTTTAAAATAACTTATTAATTAATGAATCAAATTTTTAAAAAATATCGAAA
TTAAATTTGTTTTTTTAAATGTGTAAATTTACTCGAAACTGAAACTGAATAATTTAAAAG
AATTTCACAATAATTTTGTTTTTTCAACTTTCAAAATAAATTTTGTAAGTAATAATATTT
ATTTGTTTTATAAATTGAAGAAGAAGAAGATTCAATAATTAATATTCATAAATTAGATCT
ACGAAGTATTTAAAATTTAATTAAGTAAACTTAAAATTATTTGTTATCAAAAACATGCAA
GAAAACAAAAAATAATAATTATTTGCATAACAAATTACTATGTCAAGCAATAAAATTTAA
ACAAATTAAAATATTTAAGAAATTAAGTTATTATAAATAACGCAGAATAAATCTTAAGTT
TCAATAATTGGTTTTAAATGCGGAGGGATTTATTTAGGTTCTACAAAGGATAATAAAAGA
AATGGTGAAGGAAAGTAATTCTATTCTAATGGAAACTATTACGAAGGTGAATGGTCTTAA
GATCTTCAAGATGGTATTGGTCTTTTCAAATATAATACTGGTGATTTTTACTAAGGAGAA
TTTTTTTAGGGATAATTTTAAGGATTTGGAAAATATTTTTATGCTTAAAGTAAAAGATTG
TATATTGGATTTTGGTTAAATAGTAAATGGCATGGTTAAGGCTCATTTTATAGTGATCAA
GGAGATTTATTAATTGATGGAATTTGGGAATGTGATAATCTTATCTAAGAAAATATATAA
ATAAATAAAAATATTACTTGTAAAAATGAGCCAAATACACATAAAAAATAAATAAGTATT
TAATCTCTGATAAAAAAGAGTAATTAAATATAGTCAAAAGATAATCAGAATAGTTTTAGT
ATTTAAAATATAAAAAATATTAATGGATCAAAATACAAATCATTATTATCTAATATAAAA
AATTTATTATTTTAAAATAAACATTAAAAACTAAAATAGTGTTTAATTGAATAAAGTGTT
ATTATATGA