Identifiers and Description

Gene Model Identifier

TTHERM_00581840

Standard Name

MRNO12 (Membrane Occupation and Recognition Nexus protein other)

Aliases

PreTt25622 | 79.m00136 | 3827.m00849

Description

MORN repeat protein; Protein with predicted MORN domains localized throughout the protein and/or associated with other domains having a predicted function. Chlamydial polymorphic outer membrane protein repeat containing protein.

Genome Browser (Macronucleus)

GBrowse

Genome Browser (Micronucleus)

GBrowse

Gene Ontology Annotations

No Data fetched for Gene Ontology Annotations

Domains

No Data fetched for Domains

Gene Expression Profile

  • Tetrahymena Functional Genomics Database:

Change in Gene Expression

TMHMM

TMHMM

Signal Peptide

Signal Peptide Present?: No
Presense Probability: 10.1%

TetraMine Data

TTHERM_00581840

WebApollo

Fullscreen View

Tetrahymena Stock Center

No Data fetched for StockID

Homologs (v.2006 protein sequences)

SourceIdentifierScoreDescription
Tetrahymena borealisEI9_07409.19.997093137033517e-262hypothetical protein (2641 aa)
OxytrichaContig9740.0.g652.000620012690291e-23Vpu protein
DictyBaseDDB_G02805853.001003044337619e-17ubqK on chromosome: 3 position
3532604 to 3533548

General Information

No Data fetched for General Information

Associated Literature

No Data fetched for Associated Literature

Sequences

>TTHERM_00581840(coding)
ATGGGTGCTGGTTGCTGTAAAGTAGATTAAGGAGTATCTTTAGATTAAAGCAGCATCGGG
AGTTAATCCAAGCCTGTTGAATACGAGAATGTAGATTTGAATAAATAAACTGATTAAGAT
TAGGAAACAAATCATTTTTTGCTTAATCTAGAACTTAAAAACAGCAAATAAAATCATGAA
AATGGAGATGAAGAGGACTTCGAACTTGAGATATAATTTAAGGATATTTAAAAATATTAG
GAACTTGTTTGTGATGGATGCATATTATTAGATAAAGAACCTGAAATTAACAACAGCATA
ATATTACTGATGGAAAAGAATTATGGAAAATTTAAATACTATAAATAGCAGTACGAATGT
AATGAAGCCACTTATTGTCCTCCAGCTAAACTTTTAGATGGTTCTATATATACAGGTTAG
TGGCTGAATAAGCAGTTTCATGGAAGAGGAAAGCTAATAACAGAAGAAGAATGTATTTAT
TAAGGGTATTTTTGTCATGGAAAGAAATAAGGATATGGTAGAATGTTATTTAGCAGTGGC
GACTACTACTAGGGAGAGTGGTTTGATGATTAAATGGAAGGATAGGGAATCTTAATTTTG
AGAGATGGCTCTTAATTTCAGGGCTATTTCTATTAAAGTATTTATATTGGTAATCAAAAG
GGCGTTAAGTTTGAAGATAAAGTCATTAAAGAAACACAAGAGCAGTAAATAACTACAATA
AAAAAGATTATAAGTGAAAATTAATCGCAATATGAAAATAGTTAGAAAAATAATATTAAT
AGTGCTAATAATATAGAAAATGTATAAAAGAAATCATAGTCATAATTTAAAAAATTCTAG
GATTAATAGGTAATGATTTCATCAACCAATGTTTACTTAGAAGAAGAAGAGTCTAATTAG
AAGTAGGAAATTATATAGGATAATGGTAAAATATAACCTTAAAAAGTCACTGGATCAGCT
TCAAATCAAGTTTAATAGAACAGTAGTAATAATTTGAACTAGCAATAGACTAATTCTTAA
GGAGTCGATACAAATAAAACTATCTTTGAAGAGAGTTTAAAATCATAGTTGTAGCAGTAA
TAATAATAAAAAAAATAAAGACTAGAAGAATACAATTCAAAGCAGTCAGAAAACTCAAAC
TCAAAGTCATAGTATTAGCAAGAAAGCTCTTAGTCTCAGCTTAAGCAAGAAAATTATTAA
GATTTTGAAAATTTGAAGCAAGAGTAGATAAAAATTTTAAGTATAAATTAAAATAGCTAA
AATCAGCTGTAATAACAATAAAATAGTGCATTTTAGCTTTCATAAATGAATTATACTAGA
AGAGAAGAGTAAGATTAGAAAAATTAAAATGGAAACGAATAAAGTTAAAATGAGGGGGAA
GAAGGAGATGAAAAAAACTCAAGAAATTCGAGTATGATTAGTTTAAAATATAAAAGAAGA
ATCACACACTGTGGAGATAGGCTGGTAAATCTTAATCCAGATGTAAATAGAGGTTTGGAT
GTTAGCAATATAGAATTCAATGACATATTGTCCAAGTATTTAAATGGATTGAAGGAAAAT
AATGATATTAATCATCAAGAATAATAAGAAGAAGAAAATTAGAGCATGATAATGATAAGC
TTTTAAGAAATGATGCCTAAAAATATGAGGTAAAAGTTGGCTTTCTTTTAAGAACTTTTA
AACCTAAATAATTTCCACCATGATGATGTTTAAGGAAAGGTTGTAGACTAAATGGATTTC
TAGACATTCAGAATTTATCAATAAAAGCAAACATACAAAATTCTACAAGAGAAATAAGTT
TAAAATGAGATGATTTATAAAAAAAGAGTTCAATAATAAAATGAGCTCATAGAAAATGCT
ATTTTAAATAAAATCATAGCGAGAGAAGATAAAGAAACTTATAAGCACTTAGCTATATTA
GGAATGAAGCAGATTTATGAAAAGTAAGGAGTCTTAGTCAGATTGATTGATTAAAAAGAG
GAAAAACAAGAAGATGAAAGAGACAGAAATTTCGATGCAGTTAAGTAGCATTTAATATAA
TCTGGCTTTGTAATGTAAAATTATTATTCTGCAACACTCAGTCAGAAATCTCAATGGAAA
TTTGATTTGGCTATAAATAGCAAAAGAAAATTTGCTGATTATTTTAAAAGCATAATCTTA
TTATAAAACAGAGAGTTAACAGCTAAAAATATAATTATACTGGGCTTAATAGGTGGTGAA
AAAGAGTAAATAAAGATTGACTTCTACATTAAAAATGAAGTAACTCCTATAAAAGTTAAT
ACTATTAACAAAGGTGAAATAACAGAATTTTAAAAATACCCAATAATAGACGAGATAACG
ATAAACATAGAAACTTTCTTTGATAATCAATGGAATATGATCTATGATAACACAATTATA
TGTTAATATAGAGGAAATATTAATGGATAAAAGTAATAATATTTTAGGCCTCTAGGGTAT
TTTGGATGTGCTCTCAAAGTGGTTAACAAATATCCTAACGATGGCTGGATTAGAGATGAT
ACAAGTGATAAAACTTGGATAGTGCTTTTCCATGGTAATAAAAAATTATCAACTCAAGAA
TTAATTGAAGAAGGGTATAAGTAGGGAGGATTGTAATAGTATCAAGGACATCAGTGCAGA
TTTGGAAGAGGTCTTATCAAACAAGGGATATACTTTTATGAAAAAATACAAGATGCCGAA
AAACACGCTGACACCTTTTTTATTAATGATAAGTAATACAATTTGCTATTTTAATGCAGA
GTAAATCCCAAAACTGTGAAAAGTCCGATTAACAAGCCTTCTTGCTATGTTGCTAATGAT
CCGAAAGATGTCAGACCTTACAGAATTTTAATTAAAGAAGTGAATATTCAAGATGAAATT
CCGAGTATCTGA


>TTHERM_00581840(protein)
MGAGCCKVDQGVSLDQSSIGSQSKPVEYENVDLNKQTDQDQETNHFLLNLELKNSKQNHE
NGDEEDFELEIQFKDIQKYQELVCDGCILLDKEPEINNSIILLMEKNYGKFKYYKQQYEC
NEATYCPPAKLLDGSIYTGQWLNKQFHGRGKLITEEECIYQGYFCHGKKQGYGRMLFSSG
DYYQGEWFDDQMEGQGILILRDGSQFQGYFYQSIYIGNQKGVKFEDKVIKETQEQQITTI
KKIISENQSQYENSQKNNINSANNIENVQKKSQSQFKKFQDQQVMISSTNVYLEEEESNQ
KQEIIQDNGKIQPQKVTGSASNQVQQNSSNNLNQQQTNSQGVDTNKTIFEESLKSQLQQQ
QQQKKQRLEEYNSKQSENSNSKSQYQQESSQSQLKQENYQDFENLKQEQIKILSINQNSQ
NQLQQQQNSAFQLSQMNYTRREEQDQKNQNGNEQSQNEGEEGDEKNSRNSSMISLKYKRR
ITHCGDRLVNLNPDVNRGLDVSNIEFNDILSKYLNGLKENNDINHQEQQEEENQSMIMIS
FQEMMPKNMRQKLAFFQELLNLNNFHHDDVQGKVVDQMDFQTFRIYQQKQTYKILQEKQV
QNEMIYKKRVQQQNELIENAILNKIIAREDKETYKHLAILGMKQIYEKQGVLVRLIDQKE
EKQEDERDRNFDAVKQHLIQSGFVMQNYYSATLSQKSQWKFDLAINSKRKFADYFKSIIL
LQNRELTAKNIIILGLIGGEKEQIKIDFYIKNEVTPIKVNTINKGEITEFQKYPIIDEIT
INIETFFDNQWNMIYDNTIICQYRGNINGQKQQYFRPLGYFGCALKVVNKYPNDGWIRDD
TSDKTWIVLFHGNKKLSTQELIEEGYKQGGLQQYQGHQCRFGRGLIKQGIYFYEKIQDAE
KHADTFFINDKQYNLLFQCRVNPKTVKSPINKPSCYVANDPKDVRPYRILIKEVNIQDEI
PSI


>TTHERM_00581840(gene)
ATGGGTGCTGGTTGCTGTAAAGTAGATTAAGGAGTATCTTTAGATTAAAGCAGCATCGGG
AGTTAATCCAAGCCTGTTGAATACGAGAATGTAGATTTGAATAAATAAACTGATTAAGAT
TAGGAAACAAATCATTTTTTGCTTAATCTAGAACTTAAAAACAGCAAATAAAATCATGAA
AATGGAGATGAAGAGGACTTCGAACTTGAGATATAATTTAAGGATATTTAAAAATATTAG
GAACTTGTTTGTGATGGATGCATATTATTAGATAAAGAACCTGAAATTAACAACAGCATA
ATATTACTGATGGAAAAGAATTATGGAAAATTTAAATACTATAAATAGCAGTACGAATGT
AATGAAGCCACTTATTGTCCTCCAGCTAAACTTTTAGATGGTTCTATATATACAGGTTAG
TGGCTGAATAAGCAGTTTCATGGAAGAGGAAAGCTAATAACAGAAGAAGAATGTATTTAT
TAAGGGTATTTTTGTCATGGAAAGAAATAAGGATATGGTAGAATGTTATTTAGCAGTGGC
GACTACTACTAGGGAGAGTGGTTTGATGATTAAATGGAAGGATAGGGAATCTTAATTTTG
AGAGATGGCTCTTAATTTCAGGGCTATTTCTATTAAAGTATTTATATTGGTAATCAAAAG
GGCGTTAAGTTTGAAGATAAAGTCATTAAAGAAACACAAGAGCAGTAAATAACTACAATA
AAAAAGATTATAAGTGAAAATTAATCGCAATATGAAAATAGTTAGAAAAATAATATTAAT
AGTGCTAATAATATAGAAAATGTATAAAAGAAATCATAGTCATAATTTAAAAAATTCTAG
GATTAATAGGTAATGATTTCATCAACCAATGTTTACTTAGAAGAAGAAGAGTCTAATTAG
AAGTAGGAAATTATATAGGATAATGGTAAAATATAACCTTAAAAAGTCACTGGATCAGCT
TCAAATCAAGTTTAATAGAACAGTAGTAATAATTTGAACTAGCAATAGACTAATTCTTAA
GGAGTCGATACAAATAAAACTATCTTTGAAGAGAGTTTAAAATCATAGTTGTAGCAGTAA
TAATAATAAAAAAAATAAAGACTAGAAGAATACAATTCAAAGCAGTCAGAAAACTCAAAC
TCAAAGTCATAGTATTAGCAAGAAAGCTCTTAGTCTCAGCTTAAGCAAGAAAATTATTAA
GATTTTGAAAATTTGAAGCAAGAGTAGATAAAAATTTTAAGTATAAATTAAAATAGCTAA
AATCAGCTGTAATAACAATAAAATAGTGCATTTTAGCTTTCATAAATGAATTATACTAGA
AGAGAAGAGTAAGATTAGAAAAATTAAAATGGAAACGAATAAAGTTAAAATGAGGGGGAA
GAAGGAGATGAAAAAAACTCAAGAAATTCGAGTATGATTAGTTTAAAATATAAAAGAAGA
ATCACACACTGTGGAGATAGGCTGGTAAATCTTAATCCAGATGTAAATAGAGGTTTGGAT
GTTAGCAATATAGAATTCAATGACATATTGTCCAAGTATTTAAATGGATTGAAGGAAAAT
AATGATATTAATCATCAAGAATAATAAGAAGAAGAAAATTAGAGCATGATAATGATAAGC
TTTTAAGAAATGATGCCTAAAAATATGAGGTAAAAGTTGGCTTTCTTTTAAGAACTTTTA
AACCTAAATAATTTCCACCATGATGATGTTTAAGGAAAGGTTGTAGACTAAATGGATTTC
TAGACATTCAGAATTTATCAATAAAAGCAAACATACAAAATTCTACAAGAGAAATAAGTT
TAAAATGAGATGATTTATAAAAAAAGAGTTCAATAATAAAATGAGCTCATAGAAAATGCT
ATTTTAAATAAAATCATAGCGAGAGAAGATAAAGAAACTTATAAGCACTTAGCTATATTA
GGAATGAAGCAGATTTATGAAAAGTAAGGAGTCTTAGTCAGATTGATTGATTAAAAAGAG
GAAAAACAAGAAGATGAAAGAGACAGAAATTTCGATGCAGTTAAGTAGCATTTAATATAA
TCTGGCTTTGTAATGTAAAATTATTATTCTGCAACACTCAGTCAGAAATCTCAATGGAAA
TTTGATTTGGCTATAAATAGCAAAAGAAAATTTGCTGATTATTTTAAAAGCATAATCTTA
TTATAAAACAGAGAGTTAACAGCTAAAAATATAATTATACTGGGCTTAATAGGTGGTGAA
AAAGAGTAAATAAAGATTGACTTCTACATTAAAAATGAAGTAACTCCTATAAAAGTTAAT
ACTATTAACAAAGGTGAAATAACAGAATTTTAAAAATACCCAATAATAGACGAGATAACG
ATAAACATAGAAACTTTCTTTGATAATCAATGGAATATGATCTATGATAACACAATTATA
TGTTAATATAGAGGAAATATTAATGGATAAAAGTAATAATATTTTAGGCCTCTAGGGTAT
TTTGGATGTGCTCTCAAAGTGGTTAACAAATATCCTAACGATGGCTGGATTAGAGATGAT
ACAAGTGATAAAACTTGGATAGTGCTTTTCCATGGTAATAAAAAATTATCAACTCAAGAA
TTAATTGAAGAAGGGTATAAGTAGGGAGGATTGTAATAGTATCAAGGACATCAGTGCAGA
TTTGGAAGAGGTCTTATCAAACAAGGGATATACTTTTATGAAAAAATACAAGATGCCGAA
AAACACGCTGACACCTTTTTTATTAATGATAAGTAATACAATTTGCTATTTTAATGCAGA
GTAAATCCCAAAACTGTGAAAAGTCCGATTAACAAGCCTTCTTGCTATGTTGCTAATGAT
CCGAAAGATGTCAGACCTTACAGAATTTTAATTAAAGAAGTGAATGTAAAAAATATTCTT
AAATAAAATAAATTTTTTATCTTTTATTTATAATTCCAAAAGATTCAAGATGAAATTCCG
AGTATCTGA