Identifiers and Description

Gene Model Identifier

TTHERM_00550820

Standard Name

MRNO11 (Membrane Occupation and Recognition Nexus protein other)

Aliases

PreTt29190 | 72.m00113

Description

Protein with predicted MORN domains localized throughout the protein and/or associated with other domains having a predicted function. Sequence similarity to a protein kinase family unique to Tetrahymena thermophila (Eisen et al., 2006)."

Genome Browser (Macronucleus)

GBrowse

Genome Browser (Micronucleus)

GBrowse

Gene Ontology Annotations

No Data fetched for Gene Ontology Annotations

Domains

Gene Expression Profile

  • Tetrahymena Functional Genomics Database:

TetraMine Data

TTHERM_00550820

WebApollo

Fullscreen View

Tetrahymena Stock Center

No Data fetched for StockID

Homologs (v.2006 protein sequences)

SourceIdentifierScoreDescription
Tetrahymena borealisEI9_07357.19.997093137033517e-262hypothetical protein (1906 aa)
OxytrichaContig3993.0.g1065.000468829272308e-18MORN repeat
DictyBaseDDB_G03494880.0000020007268868677913DDB_G0349488 on chromosome: 2
position 6912714 to 6914186

General Information

No Data fetched for General Information

Associated Literature

No Data fetched for Associated Literature

Sequences

>TTHERM_00550820(coding)
ATGGATCAAGAGAGCTTTGAAAAAAGGGAAAGCTCACCTATTGCTTAGAGAATAGATTAG
TCTCATAATCAAAGCGCAATAGAAAACAGTTAGTTAGTTAAAAATTTAACCTAGGGGGAA
ACTTAGGAAGAAATAAATATTTCTCTTGTTATCAATTAAGGTTATGTATTTATAGTGAAT
AATGATTAAACTCCATTTGCATAAATTGCTTTTGTAGATGATTGCTATCCAAAATATAAT
GGAAAAATGGGAATTGAAAATTTTATGTAACAGAAAAATATTTAATCTGTCGCATGGACA
TCTTCATCAGATTTCATAGAAAAAATATACCCAACTCATGAAGAAAGAGAGTTGGCATTA
ACTTATTTGAAATAAAATATGAGAGATTCCAGATAGCTTTAGACTATATATGCGATTCTA
AATGAAACAGTTGATAAAGATTGGCATGAGTCAGTTGTTGAAAATCCCCTTAGCATGAAT
CTTCGAGGCATAGAGATGATCCAAGAAATGCTCCTAGAAGAATTAATTTTCCTTTCTTTA
AGATTGTTTTTGTAGTAGGGATTTGACTAATCATTTGATGGTCTTTCAGTTTTCCTAAAA
CTATAACCACTATAACTCATTTTAGCATTTGTTGACTGCTTTCCTTCATATTCAGATTTA
GTCTACTCTTTAGTAATGAAATAGGGTATTATATAAAGGAGTATTCCAAAATCAAAAAAT
GATAGTAATAAAATTTCTAATTTAAGCTAAATAAGTTAAATGAAGTCTTCATAGTTAAAT
AGTGGATAACAAACACCTCTTCCGATGACTCACTATGAAGCTGAAAATATTTCAAATAAC
AATTAGTTAGATTTAAATAATGTTTAAAATTATTATAACAATACCTAAAATTTTAATCCA
GATTAAAATTTTGCTGCTTATATTCAATCATTTATAAGGTTTGCTTAAGTAAAAAGAGAA
GGAGATAATAAATATGATTTTACAACTCTCATAGATGCATAAGGAAGAATCGATTTGTTA
AAAGAAATTATTTCTGAGTTAGATTGTTCCTTGCCAAATGTTTTAAAATAACTTGGGGTT
AAAGAAAGATAGTCTAACGATTTTCTAAAAAAATAGTTTATATAGCAAATTAAAAACATC
AGAACTTGCATAAATAACTCCGCCATGAAAAATGCAGTCGAAGTAAATGAAGATGAAGGA
GCTATTGTTGATAGAATATAAACCGAATCAGACCTTGATGAATACTCTTATGAGAAGTCT
CATCAAGATTATTTATTTTATGCAGATAGAGAGGATGAAATCAATTACTAACAATAGCAA
ACCCTCTATCAAGTTGCACCAAAAATTAATTTTGAATAGCATCGCTTAGAAGCATGGAAC
TAGCTCTATGATAAGATTAAATAAGGAGTTCCTCTCTCTAAATATGAAGAAGATTAATGG
AGATATTTCGCTTTTGAGGATAATTTTTAAAATGCATTGATTACTCTCGGAGAAAAAGTG
CTTATCCAAGATTAAGACATAAAATCTGCATTAAAATGCTATCAAATATTGTTCTGTCTT
GGTCATCGATAAAGTTCAACAATTTTATATAGTTTATTATGTTTGACTTAAGAATTTAGC
TAAGCATAAGCATTAATTATGAACACTAACTTAAATGTACAAAAATCATACATATTAATG
AAACTTAATCAGCATAAAGAAGCAATAGATTTAATAAATAGAAACTTTAAAACATCAACT
TAAATAGGAAGTAAAATATAGTTCTGCTATATCCTTTCTAATATGCTATAAAAACAGAGC
AAATATCTAGCAGCATTGACAGCCTTTTAAATTTTGAACAAAAGTTCAAGCTCAAGCTAA
GATTTGAGCTTAATTTTTAAGCTTTTTTTGATTGGTAAGCTTGTATAAAAAGGACTTTAT
TTTTAGCAATAAGAATCTGCAGCAATAAAGATTTACAACTACATATTAAATAATTTAAAG
CCAGCTTATATGTATGAATTTATCACTTTTTTCTTCATTAAGCAATCAAAAGATGAGATA
AAATAATCAAAAAATAATTTTGCTCAATAAGTTATTGTAGGAGCTTCTAAGAATTCTAAT
GTAAAGGGTAGTATTTCTAATTAAATGAAAGGAAGTTCTTTACTCAGACAAGAAAGTAGT
CACCTATCTAGTAAAAGCTAAAACTCAACCATGAAAATTTAAAGCGATTACTAATCAACT
TTTTAAAATAAACCATCAGCTGAAAAAGCAGAAAAAACTTAACCAATTCCTTGGGACTAA
TTAATTTCTAATACACTTAACATTTAAATTTAAGACATTAGAATTTTCCTAGAAAAAGAA
CATCAGCGATTCTATAATATAATTCATAATATAAACACTGACCACGAAACAAGACGTGAT
TATCTCATAGCTCACACTCTAGGAAACTCAATTTTATTTAAATCTGAAAAAGAGTATAAT
AGAAGCTATTTCGATGAAAATAAATCAGGAATTCTAAGGTAAAACCAAAGATTTTGTAAA
ATTCTTAGCGATTTTTCAAACCCAACAATGATGTGGCCTCTAACTTTAGTCAAACCTTAT
GAAGATAATTAATCATTTAATTAAAAAAATCGTAACGAAGAAAGTTAAACTAAACAGTAG
TAATAGTCTACTGAAGATGGAGATGTAAAAAAAGAAAAAAATAACAACCTTCCATTGATA
AAATAAAACTTTTTGAATAATGGGAATTATTAATTTGAAGGAAGACTTGTTCAAAATCTA
CCTCCAAGACTGAATTAAGATGAAATTATTATGCATTCCGATGAAAGAGATGTTAAAAGA
TAATTAGGACATTTTACAATTAATAATTAAATATTTTCAAAGTGGGTTGTTAAATCTAAA
TACCTTTTTGAAGATAATGGCGATACTAATTTCTTGAATTTAGCATTTAATGTTTCTCCT
TATTTTTTAAATATTTATGCTATTTCACATTAAGACTCTTCCATATTAACTGAGCCTTAC
TTGTGCACTTTCGAAGAGCTTTGTTAAAATAAATTATCTGATTATAACATAGACGAATAG
CTAAGTGGTAAACTAATTAAAGAAATATCTGGGCTTTTCTAAATAGTTTCTCTGTGTGTT
TCACTTCATAATAGCGAGCTTTATGGATATATTTCCTTCTTTGGCAAAAATATTCTCCTA
GTTGACAATGAAGGATTTATAAAAACTCCAAATTTCTTAGTTTTAGTGGATGGAAGCTTT
TAGCTAGATTGGAATACAATCCCTCATGAACTGCTTTTAGAAGAAGGACCTCAGTAATAA
CTATCTAAATGTGATATTTGGGGCATTGGTAGTCTCCTACTGTATTTATTTTACGGAAAA
AGCATAGTTAATGAAACTAATTCCTAAAAATAAGTTGATAAATATCTTTAGGATGTGAAC
AAATTCAAGACATAGGAATACCTAGATGATTTATTTGCATAATTTAATATTAAATCTGAG
AAAAACACTAAAAATTAGTAAGATTAAAAAGAACATTAAAACGAAGAATCTAATCAACCT
GGTAGGTATTTTGAAGTCTCTAGCATGAGTTATGAGTTTAGATGGCTTTTAGAAAGCATA
ATTAGAAAATGTTTGAGATACGAAGCTGTCTCAAGACCAAGTGCTCTTGAATTACTCTTA
GAAATTCATGAATTTATAAAAAAATCAAATCCTGAAGGTATTTTTACTCTCTATAACATT
GACAGTGTTTCAACCAAAATTAAATCATTAAAAAGAATCTAATATTGTACAAAATAAGAA
GGGCAAAAACAGGAAGATAAATACTTTAAATAGAGCAGTTTAAACTAAGATTCTGTTTAA
TAAGCTAAAAATAAATCAGAAGAACAAGAGGGAAGAAAAGAATAAAGCTAGTAGTTAAAT
ACAATAAAAGAAGACAATAATGAGAGTTTCTCCAAAGAGCAAGAAAAAAATACCCTTAAT
TAAAATTAGAATGACAAAGTATTTATCTAAGAAAATGGATAGCCTTAAAAGCAATTAATC
GATATGTCATAAAGAAAATCACATCCTGATTTAATATTTTCTGAAACACCTACACCTTAA
AATAGTTAAAATAGCGAGTTTAATTCTAAATTAAATGGTGGGGAATAAAGTGATTCTTAA
TACTTTAAAAACAAAGAAAATAGACCTATCTCAGCAATTAAAAAAATAGGATCATTTCCA
AAGAACTACATTTTAGATTCAATAAAAGAAAACGATTTTGAGGCAAGTAATGAATTTAAT
AGTTCTTCTTAATTTTATTTTATTCCTGGAGGTTCAGTTCTTCTTAAATAAGGAAATAAA
TCTTATTACTTCACTCCTTATAAAACAGAATATCATATTAATAGTAAACCAAAAAAACAA
GATGAAACTAGCTTAAAAGAAATTCTTACAGGGGAAGGTAAAATGCTCATGTAAGATGAT
AGAGTCTTCTAAGGATATTTTGGAAATTTCGGTTTGCCTCACAGTGGATTTTTGTTGAAC
TAGTTTACAAAAAAAACTTCAGTTTTAGGTTTTGAAGAATCTACAAGAATGCCAAGATCA
GATGCTACAAAAACATTTATTGATGATACAAAGGATAAATAAGAGCTATTCAAGGAATAG
TAGCAACTAAATAAAGTTATACAGTAGATTAATGGTCTTTTTAATTCAACTAAAAAATTC
TTGGATTTCTTTGGCAATTGGATTTCTTGTGATTTTCTAGGAAGCAATTGCACACCTTCA
ATAAATAATAAGACTAGTCCTTTATTATTCATTACTGAGAATAAAACACTTTATATCCAT
GGTTAACAAGCTAAAGCCTTTTTATTTGATTATTCAATTATGACATATTCTATATTTGAA
GAAATACCAACCCAAGGAATCGTTTCTGCATCTAGCCTGTAGCAAGAAGAAAAAATTTTA
AGCATGTTAGATTTGATCAAATCTCTATCAAATAGTTGGCATGTTGTATAGCATTTACTT
GAAGGCTGTAAATATAATGGTGGTTTATCTAACTGGGATCCTATAGATGGAAAATTGTCT
TTTTATGATACAGAAATTTAAGTAAATGGAAGTGCATAAAAAAGTTTAATTTATTAAACT
GTTTTAACTTTCCCTACTGGAGATTGCTATAAAGGTGGTCTTTTGAATGGCAAGTATTGG
GATTACGGTAGACTTTATAGTAATAACAGATTAGTTCTAGAAGGAAAGTTTGTTGATAAT
TCTATGATTTATGGAACTTTGTATTACACTGATGATAAAATTAAATATGTTGGAGAAGTG
TTTTTTGATGAATCAGATGATAGTTACAAGAAGCATGGCAAAGGAACGCTTTATATGAGA
AATGGAGATATTTATGAAGGTGACTTTTCGCTAGATTTATATCATGGTTTTGGAAAGATT
TTATATGATGGTGGAAAAAAAGGTTACTTCGAAGGAGTATTCAATGAGGGTCTAAAGCAT
GGTGTTGGAGTTTATTGCGATAAAATTAAAGGTATTGAATTTAATGGAGAATACGAGTAT
AATAAAAGATCTAAGTATGGGATAGAAAAGGTAGAAAATAAGCATGAGTATTAAGGAAAC
TTTAAAGAGGGTAAAAAACATGGTCATGGAGTAATCTACTATAAAAAAGGTAAAATAAAA
TACTATGATGGTACATTTGAGGATGATAAAAAGCATGGAGGAGGAATTGAAATTGATGAG
AATGATAATAAGTATTTAGTTAAATACTGGAAAGATGGTTTAATTAGCTCTAATTTAATG
AAGAAGAACATTAAAACACAGTAAACTCCACAATCTAAATAATAAGAAGATGAAAATACT
TTCTATAAGTTTATTTGA


>TTHERM_00550820(protein)
MDQESFEKRESSPIAQRIDQSHNQSAIENSQLVKNLTQGETQEEINISLVINQGYVFIVN
NDQTPFAQIAFVDDCYPKYNGKMGIENFMQQKNIQSVAWTSSSDFIEKIYPTHEERELAL
TYLKQNMRDSRQLQTIYAILNETVDKDWHESVVENPLSMNLRGIEMIQEMLLEELIFLSL
RLFLQQGFDQSFDGLSVFLKLQPLQLILAFVDCFPSYSDLVYSLVMKQGIIQRSIPKSKN
DSNKISNLSQISQMKSSQLNSGQQTPLPMTHYEAENISNNNQLDLNNVQNYYNNTQNFNP
DQNFAAYIQSFIRFAQVKREGDNKYDFTTLIDAQGRIDLLKEIISELDCSLPNVLKQLGV
KERQSNDFLKKQFIQQIKNIRTCINNSAMKNAVEVNEDEGAIVDRIQTESDLDEYSYEKS
HQDYLFYADREDEINYQQQQTLYQVAPKINFEQHRLEAWNQLYDKIKQGVPLSKYEEDQW
RYFAFEDNFQNALITLGEKVLIQDQDIKSALKCYQILFCLGHRQSSTILYSLLCLTQEFS
QAQALIMNTNLNVQKSYILMKLNQHKEAIDLINRNFKTSTQIGSKIQFCYILSNMLQKQS
KYLAALTAFQILNKSSSSSQDLSLIFKLFLIGKLVQKGLYFQQQESAAIKIYNYILNNLK
PAYMYEFITFFFIKQSKDEIKQSKNNFAQQVIVGASKNSNVKGSISNQMKGSSLLRQESS
HLSSKSQNSTMKIQSDYQSTFQNKPSAEKAEKTQPIPWDQLISNTLNIQIQDIRIFLEKE
HQRFYNIIHNINTDHETRRDYLIAHTLGNSILFKSEKEYNRSYFDENKSGILRQNQRFCK
ILSDFSNPTMMWPLTLVKPYEDNQSFNQKNRNEESQTKQQQQSTEDGDVKKEKNNNLPLI
KQNFLNNGNYQFEGRLVQNLPPRLNQDEIIMHSDERDVKRQLGHFTINNQIFSKWVVKSK
YLFEDNGDTNFLNLAFNVSPYFLNIYAISHQDSSILTEPYLCTFEELCQNKLSDYNIDEQ
LSGKLIKEISGLFQIVSLCVSLHNSELYGYISFFGKNILLVDNEGFIKTPNFLVLVDGSF
QLDWNTIPHELLLEEGPQQQLSKCDIWGIGSLLLYLFYGKSIVNETNSQKQVDKYLQDVN
KFKTQEYLDDLFAQFNIKSEKNTKNQQDQKEHQNEESNQPGRYFEVSSMSYEFRWLLESI
IRKCLRYEAVSRPSALELLLEIHEFIKKSNPEGIFTLYNIDSVSTKIKSLKRIQYCTKQE
GQKQEDKYFKQSSLNQDSVQQAKNKSEEQEGRKEQSQQLNTIKEDNNESFSKEQEKNTLN
QNQNDKVFIQENGQPQKQLIDMSQRKSHPDLIFSETPTPQNSQNSEFNSKLNGGEQSDSQ
YFKNKENRPISAIKKIGSFPKNYILDSIKENDFEASNEFNSSSQFYFIPGGSVLLKQGNK
SYYFTPYKTEYHINSKPKKQDETSLKEILTGEGKMLMQDDRVFQGYFGNFGLPHSGFLLN
QFTKKTSVLGFEESTRMPRSDATKTFIDDTKDKQELFKEQQQLNKVIQQINGLFNSTKKF
LDFFGNWISCDFLGSNCTPSINNKTSPLLFITENKTLYIHGQQAKAFLFDYSIMTYSIFE
EIPTQGIVSASSLQQEEKILSMLDLIKSLSNSWHVVQHLLEGCKYNGGLSNWDPIDGKLS
FYDTEIQVNGSAQKSLIYQTVLTFPTGDCYKGGLLNGKYWDYGRLYSNNRLVLEGKFVDN
SMIYGTLYYTDDKIKYVGEVFFDESDDSYKKHGKGTLYMRNGDIYEGDFSLDLYHGFGKI
LYDGGKKGYFEGVFNEGLKHGVGVYCDKIKGIEFNGEYEYNKRSKYGIEKVENKHEYQGN
FKEGKKHGHGVIYYKKGKIKYYDGTFEDDKKHGGGIEIDENDNKYLVKYWKDGLISSNLM
KKNIKTQQTPQSKQQEDENTFYKFI


>TTHERM_00550820(gene)
ATGGATCAAGAGAGCTTTGAAAAAAGGGAAAGCTCACCTATTGCTTAGAGAATAGATTAG
TCTCATAATCAAAGCGCAATAGAAAACAGTTAGTTAGTTAAAAATTTAACCTAGGGGGAA
ACTTAGGAAGAAATAAATATTTCTCTTGTTATCAATTAAGGTTATGTATTTATAGTGAAT
AATGATTAAACTCCATTTGCATAAATTGCTTTTGTAGATGATTGCTATCCAAAATATAAT
GGAAAAATGGGAATTGAAAATTTTATGTAACAGAAAAATATTTAATCTGTCGCATGGACA
TCTTCATCAGATTTCATAGAAAAAATATACCCAACTCATGAAGAAAGAGAGTTGGCATTA
ACTTATTTGAAATAAAATATGAGAGATTCCAGATAGCTTTAGACTATATATGCGATTCTA
AATGAAACAGTTGATAAAGATTGGCATGAGTCAGTTGTTGAAAATCCCCTTAGCATGAAT
CTTCGAGGCATAGAGATGATCCAAGAAATGCTCCTAGAAGAATTAATTTTCCTTTCTTTA
AGATTGTTTTTGTAGTAGGGATTTGACTAATCATTTGATGGTCTTTCAGTTTTCCTAAAA
CTATAACCACTATAACTCATTTTAGCATTTGTTGACTGCTTTCCTTCATATTCAGATTTA
GTCTACTCTTTAGTAATGAAATAGGGTATTATATAAAGGAGTATTCCAAAATCAAAAAAT
GATAGTAATAAAATTTCTAATTTAAGCTAAATAAGTTAAATGAAGTCTTCATAGTTAAAT
AGTGGATAACAAACACCTCTTCCGATGACTCACTATGAAGCTGAAAATATTTCAAATAAC
AATTAGTTAGATTTAAATAATGTTTAAAATTATTATAACAATACCTAAAATTTTAATCCA
GATTAAAATTTTGCTGCTTATATTCAATCATTTATAAGGTTTGCTTAAGTAAAAAGAGAA
GGAGATAATAAATATGATTTTACAACTCTCATAGATGCATAAGGAAGAATCGATTTGTTA
AAAGAAATTATTTCTGAGTTAGATTGTTCCTTGCCAAATGTTTTAAAATAACTTGGGGTT
AAAGAAAGATAGTCTAACGATTTTCTAAAAAAATAGTTTATATAGCAAATTAAAAACATC
AGAACTTGCATAAATAACTCCGCCATGAAAAATGCAGTCGAAGTAAATGAAGATGAAGGA
GCTATTGTTGATAGAATATAAACCGAATCAGACCTTGATGAATACTCTTATGAGAAGTCT
CATCAAGATTATTTATTTTATGCAGATAGAGAGGATGAAATCAATTACTAACAATAGCAA
ACCCTCTATCAAGTTGCACCAAAAATTAATTTTGAATAGCATCGCTTAGAAGCATGGAAC
TAGCTCTATGATAAGATTAAATAAGGAGTTCCTCTCTCTAAATATGAAGAAGATTAATGG
AGATATTTCGCTTTTGAGGTAATTTTAAAATTAATAAAAATGATTTCTATCACTTTAAAT
ATTTATTTTAATTTATATCTAATTTAATTAGGTATTTTATCAATTATTTGATTCTTAATT
AAGGGGGGGAGTAAAGTTAAATAAAAGGAACTCCATTTTTCTTCCCTATAAATTACCATA
AATAGAAATATTATTGGTTTTGTTCTAAAATCCTACATACCCCCCTTTACTAATAAGAAA
ATTTAAAACTTTTTCAATTTTACAAAATTAATTAAAAAGTATTTTTCTTTAAAATTAAAA
TTAAATTTAAGATAACATTTTAACAAATTTAAATTAAAGAATATATTTTCATTGAATATT
TAATTGAATATAAATAGGATAATTTTTAAAATGCATTGATTACTCTCGGAGAAAAAGTGC
TTATCCAAGATTAAGACATAAAATCTGCATTAAAATGCTATCAAATATTGTTCTGTCTTG
GTCATCGATAAAGTTCAACAATTTTATATAGTTTATTATGTTTGACTTAAGAATTTAGCT
AAGCATAAGCATTAATTATGAACACTAACTTAAATGTACAAAAATCATACATATTAATGA
AACTTAATCAGCATAAAGAAGCAATAGATTTAATAAATAGAAACTTTAAAACATCAACTT
AAATAGGAAGTAAAATATAGTTCTGCTATATCCTTTCTAATATGCTATAAAAACAGAGCA
AATATCTAGCAGCATTGACAGCCTTTTAAATTTTGAACAAAAGTTCAAGCTCAAGCTAAG
ATTTGAGCTTAATTTTTAAGCTTTTTTTGATTGGTAAGCTTGTATAAAAAGGACTTTATT
TTTAGCAATAAGAATCTGCAGCAATAAAGATTTACAACTACATATTAAATAATTTAAAGC
CAGCTTATATGTATGAATTTATCACTTTTTTCTTCATTAAGCAATCAAAAGATGAGATAA
AATAATCAAAAAATAATTTTGCTCAATAAGTTATTGTAGGAGCTTCTAAGAATTCTAATG
TAAAGGGTAGTATTTCTAATTAAATGAAAGGAAGTTCTTTACTCAGACAAGAAAGTAGTC
ACCTATCTAGTAAAAGCTAAAACTCAACCATGAAAATTTAAAGCGATTACTAATCAACTT
TTTAAAATAAACCATCAGCTGAAAAAGCAGAAAAAACTTAACCAATTCCTTGGGACTAAT
TAATTTCTAATACACTTAACATTTGTAAAATTAATTTTAAAGAAGTTTAGCTAAAATATA
TTTTTTTAAATAGAAATTTAAGACATTAGAATTTTCCTAGAAAAAGAACATCAGCGATTC
TATAATATAATTCATAATATAAACACTGACCACGAAACAAGACGTGATTATCTCATAGCT
CACACTCTAGGAAACTCAATTTTATTTAAGTATTTTCTTTATTTGTATGTATGTCATTTA
AAATATTTTTTAGATCTGAAAAAGAGTATAATAGAAGCTATTTCGATGAAAATAAATCAG
GAATTCTAAGGTAAAACCAAAGATTTTGTAAAATTCTTAGCGATTTTTCAAACCCAACAA
TGATGTGGCCTCTAACTTTAGTCAAACCTTATGAAGATAATTAATCATTTAATTAAAGTA
ATTTTTTCTATCATTTTAAATAGCTGATTAAAATAATATCGCAAAAATAAAGAAAATCGT
AACGAAGAAAGTTAAACTAAACAGTAGTAATAGTCTACTGAAGATGGAGATGTAAAAAAA
GAAAAAAATAACAACCTTCCATTGATAAAATAAAACTTTTTGAATAATGGGAATTATTAA
TTTGAAGGAAGACTTGTTCAAAATCTACCTCCAAGACTGAATTAAGATGAAATTATTATG
CATTCCGATGAAAGAGATGTTAAAAGATAATTAGGACATTTTACAATTAATAATTAAATA
TTTTCAAAGTGGGTTGTTAAATCTAAATACCTTTTTGAAGATAATGGCGATACTAATTTC
TTGAATTTAGCATTTAATGTTTCTCCTTATTTTTTAAATATTTATGCTATTTCACATTAA
GACTCTTCCATATTAACTGAGCCTTACTTGTGCACTTTCGAAGAGCTTTGTTAAAATAAA
TTATCTGATTATAACATAGACGAATAGCTAAGTGGTAAACTAATTAAAGAAATATCTGGG
CTTTTCTAAATAGTTTCTCTGTGTGTTTCACTTCATAATAGCGAGCTTTATGGATATATT
TCCTTCTTTGGCAAAAATATTCTCCTAGTTGACAATGAAGGATTTATAAAAACTCCAAAT
TTCTTAGTTTTAGTGGATGGAAGCTTTTAGCTAGATTGGAATACAATCCCTCATGAACTG
CTTTTAGAAGAAGGACCTCAGTAATAACTATCTAAATGTGATATTTGGGGCATTGGTAGT
CTCCTACTGTATTTATTTTACGGAAAAAGCATAGTTAATGAAACTAATTCCTAAAAATAA
GTTGATAAATATCTTTAGGATGTGAACAAATTCAAGACATAGGAATACCTAGATGATTTA
TTTGCATAATTTAATATTAAATCTGAGAAAAACACTAAAAATTAGTAAGATTAAAAAGAA
CATTAAAACGAAGAATCTAATCAACCTGGTAGGTATTTTGAAGTCTCTAGCATGAGTTAT
GAGTTTAGATGGCTTTTAGAAAGCATAATTAGAAAATGTTTGAGATACGAAGCTGTCTCA
AGACCAAGTGCTCTTGAATTACTCTTAGAAATTCATGAATTTATAAAAAAATCAAATCCT
GAAGGTATTTTTACTCTCTATAACATTGACAGTGTTTCAACCAAAATTAAATCATTAAAA
AGAATCTAATATTGTACAAAATAAGAAGGGCAAAAACAGGAAGGTAATTTTAATCTTTAA
ATTATTTCTATTTTCAATAGCTATTTTAAAAATATATTATTGAGTAACATCAAAATAACT
AAATAAATAAATCAATTTTTTGTAAATTATAATTTTTTATTTAAAAAAATTAATATTTTT
GTAAAATTTGTTATTTTTTTAATTTATAACTTGATCATTTTTAATGAGAATTTAATAATT
TTTTTATTATTCAAGAGTTTAATAATTTTTAAAAATAAAAAATAAATGTAATTTTTGTAA
AGTGGTTATTCACTTTTTGTTTAATTGAATAAAATAGTTAACTGTTTTAAAAATATAATA
GATAAATACTTTAAATAGAGCAGTTTAAACTAAGATTCTGTTTAATAAGCTAAAAATAAA
TCAGAAGAACAAGAGGGAAGAAAAGAATAAAGCTAGTAGTTAAATACAATAAAAGAAGAC
AATAATGAGAGTTTCTCCAAAGAGCAAGAAAAAAATACCCTTAATTAAAATTAGAATGAC
AAAGTATTTATCTAAGAAAATGGATAGCCTTAAAAGCAATTAATCGATATGTCATAAAGA
AAATCACATCCTGATTTAATATTTTCTGAAACACCTACACCTTAAAATAGTTAAAATAGC
GAGTTTAATTCTAAATTAAATGGTGGGGAATAAAGTGATTCTTAATACTTTAAAAACAAA
GAAAATAGACCTATCTCAGCAATTAAAAAAATAGGATCATTTCCAAAGAACTACATTTTA
GATTCAATAAAAGAAAACGATTTTGAGGCAAGTAATGAATTTAATAGTTCTTCTTAATTT
TATTTTATTCCTGGAGGTTCAGTTCTTCTTAAATAAGGAAATAAATCTTATTACTTCACT
CCTTATAAAACAGAATATCATATTAATAGTAAACCAAAAGTAATAATTTAATTATTTTAA
AAGTATTATAAAATATATTTAAAATTAAAGAAACAAGATGAAACTAGCTTAAAAGAAATT
CTTACAGGGGAAGGTAAAATGCTCATGTAAGATGATAGAGTCTTCTAAGGATATTTTGGA
AATTTCGGTTTGCCTCACAGTGGATTTTTGTTGAACTAGTTTACAAAAAAAACTTCAGTT
TTAGGTTTTGAAGAATCTACAAGAATGCCAAGATCAGATGCTACAAAAACATTTATTGAT
GATACAAAGGATAAATAAGAGCTATTCAAGGAATAGTAGCAACTAAATAAAGTTATACAG
TAGATTAATGGTCTTTTTAATTCAACTAAAAAATTCTTGGATTTCTTTGGCAATTGGATT
TCTTGTGATTTTCTAGGAAGCAATTGCACACCTTCAATAAATAATAAGACTAGTCCTTTA
TTATTCATTACTGAGAATAAAACACTTTATATCCATGGTTAACAAGCTAAAGCCTTTTTA
TTTGATTATTCAATTATGACATATTCTATATTTGAAGAAATACCAACCCAAGGAATCGTT
TCTGCATCTAGCCTGTAGCAAGAAGAAAAAATTTTAAGCATGTTAGATTTGATCAAATCT
CTATCAAATAGTTGGCATGTTGTATAGCATTTACTTGAAGGCTGTAAATATAATGGTATT
ATTTATTTATTAAAATTTCTCTCAGCTATTTTTTTAATCAATTGATAGTATTTCACTATT
ATTAACTATTAATTATTTTTATTAATTATTTTTTGAATATTTATATTTTCTCTTTCTATT
TAATCAATCTGATATTAAAAAAATTAATAATTTTATCATGTTTATCTAAATAAATTATTT
TTTTTTAATTAATTAATTTATAATTATTTTATTATAATTTTTTAAATGATGTTTATTGTT
GGAGTAAATTGTATTAAATTTAATAAATTTATTTTAGACTTTTTAAAAAATGAATGATTG
AATTCTTAATAAATATTTCTAGACATTTATTGAGCTATATTATATAAATAAAGAGAAAAT
ACAAAACTAAATAATAGTTGGATTGCTTCTTTTTGAGTTTATTTATTTATCTACTATTTT
ATTAAAAAGGTGGTTTATCTAACTGGGATCCTATAGATGGAAAATTGTCTTTTTATGATA
CAGAAATTTAAGTAAATGGAAGTGCATAAAAAAGTTTAATTTATTAAACTGTTTTAACTT
TCCCTACTGGAGATTGCTATAAAGGTGGTCTTTTGAATGGCAAGTATTGGGATTACGGTA
GACTTTATAGTAATAACAGATTAGTTCTAGAAGGAAAGTTTGTTGATAATTCTATGATTT
ATGGAACTTTGTATTACACTGATGATAAAATTAAATATGTTGGAGAAGTGTTTTTTGATG
AATCAGATGATAGTTACAAGAAGCATGGCAAAGGAACGCTTTATATGAGAAATGGAGATA
TTTATGAAGGTGACTTTTCGCTAGATTTATATCATGGTTTTGGAAAGATTTTATATGATG
GTGGAAAAAAAGGTTACTTCGAAGGTAAAACTTTTATGGATAGTTAGTTTAGACTCACTA
AAATTTTTTTAATAAAATATAGGAGTATTCAATGAGGGTCTAAAGCATGGTGTTGGAGTT
TATTGCGATAAAATTAAAGGTATTGAATTTAATGGAGAATACGAGTATAATAAAAGATCT
AAGTATGGGATAGAAAAGGTAGAAAATAAGCATGAGTATTAAGGAAACTTTAAAGAGGGT
AAAAAACATGGTCATGGAGTAATCTACTATAAAAAAGGTAAAATAAAATACTATGATGGT
ACATTTGAGGATGATAAAAAGCATGGAGGAGGAATTGAAATTGATGAGAATGATAATAAG
TATTTAGTTAAATACTGGAAAGATGGTTTAATTAGCTCTAATTTAATGAAGAAGAACATT
AAAACACAGTAAACTCCACAATCTAAATAATAAGAAGATGAAAATACTTTCTATAAGTTT
ATTTGA