Identifiers and Description

Gene Model Identifier

TTHERM_01044740

Standard Name

MRNO10 (Membrane Occupation and Recognition Nexus protein other)

Aliases

PreTt05923 | 209.m00060 | 3760.m00248

Description

kinase domain protein

Genome Browser (Macronucleus)

GBrowse

Genome Browser (Micronucleus)

GBrowse

Gene Ontology Annotations

No Data fetched for Gene Ontology Annotations

Domains

No Data fetched for Domains

Gene Expression Profile

  • Tetrahymena Functional Genomics Database:

Change in Gene Expression

TMHMM

TMHMM

Signal Peptide

Signal Peptide Present?: No
Presense Probability: 10.3%

TetraMine Data

TTHERM_01044740

WebApollo

Fullscreen View

Tetrahymena Stock Center

No Data fetched for StockID

Homologs (v.2006 protein sequences)

SourceIdentifierScoreDescription
Tetrahymena borealisEI9_20383.19.997093137033517e-262hypothetical protein (1538 aa)
OxytrichaContig1068.0.0.g832.999758165421992e-18MORN repeat

General Information

No Data fetched for General Information

Associated Literature

No Data fetched for Associated Literature

Sequences

>TTHERM_01044740(coding)
ATGAACGGATATGGAAAACTTTATTACCCATCCGGCTAATTAGCGTATGAAGGTAAATGG
AAAGATGATAAATTTGATGGAAGAGGAGTTATTTATAATGAAAAGCCTATCCCTATAAGC
TATGGAGAAGAAATAGACTTTTAAGATTTTAATAAAATGTCTGAAGAATGGACAAAGTTT
GACGGAGAATTTAAAATAGATGAAAAAACTGGATTTGGAACCTTTTATTTCAGTAATTCT
TCAAAGTTTTAATGTAACTTTATGAACGATATGGCTGAAGGAGTGGGTACTTTCACATTA
TCAGATGGAAAAACTCAAATCGTTGGGGATTGGAAATAAAACATTTTAGTTAATATTTAC
CAATAAAAATAAATAAATCATTGA


>TTHERM_01044740(protein)
MNGYGKLYYPSGQLAYEGKWKDDKFDGRGVIYNEKPIPISYGEEIDFQDFNKMSEEWTKF
DGEFKIDEKTGFGTFYFSNSSKFQCNFMNDMAEGVGTFTLSDGKTQIVGDWKQNILVNIY
QQKQINH


>TTHERM_01044740(gene)
ATGAACGGATATGGAAAACTTTATTACCCATCCGGCTAATTAGCGTATGAAGGTAAATGG
AAAGATGATAAATTTGATGGAAGAGGAGTTATTTATAATGAAAAGCCTATCCCTATAAGC
TATGGAGAAGAAATAGACTTTTAAGATTTTAATAAAATGTCTGAAGAATGGACAAAGTTT
GACGGAGAATTTAAAATAGATGAAAAAACTGGATTTGGAACCTTTTATTTCAGTAATTCT
TCAAAGTTTTAATGTAACTTTATGAACGATATGGCTGAAGGAGTGGGTACTTTCACATTA
TCAGATGGAAAAACTCAAATCGTTGGGGATTGGAAATAAAACATTTTAGTTAATATTTAC
CAATAAAAATAAATAAATCATTGA