Identifiers and Description

Gene Model Identifier

TTHERM_00621420

Standard Name

MRNO09 (Membrane Occupation and Recognition Nexus protein other)

Aliases

PreTt05139 | 86.m00171

Description

Protein with predicted MORN domains localized throughout the protein and/or associated with other domains having a predicted function

Genome Browser (Macronucleus)

GBrowse

Genome Browser (Micronucleus)

GBrowse

Gene Ontology Annotations

No Data fetched for Gene Ontology Annotations

Domains

  • ( PF02493 ) MORN repeat
  • ( PF04702 ) Vicilin N terminal region
  • ( PF00644 ) Poly(ADP-ribose) polymerase catalytic domain
  • ( TIGR00013 ) 4-oxalocrotonate tautomerase family enzyme

Gene Expression Profile

  • Tetrahymena Functional Genomics Database:

TetraMine Data

TTHERM_00621420

WebApollo

Fullscreen View

Tetrahymena Stock Center

No Data fetched for StockID

Homologs (v.2006 protein sequences)

SourceIdentifierScoreDescription
Tetrahymena borealisEI9_00216.19.997093137033517e-262DNA polymerase catalytic subun
it (3569 aa)
DictyBaseDDB_G02805851.000361553249356e-16ubqK on chromosome: 3 position
3532604 to 3533548
OxytrichaContig16718.0.g1030.0000000000009003435339752751MORN repeat

General Information

No Data fetched for General Information

Associated Literature

No Data fetched for Associated Literature

Sequences

>TTHERM_00621420(coding)
ATGTATCAAAATAATGACAATAGTTATAATGAAGTTCTCTAAGATGGAAGAATGATGAGA
ATGATTTCTATGCTTCAGCCTCTTGGAGAAAGACGCAGACTTAGGAAGATTAATTACTTG
TTTCTTAATTCAGACTATATAGCAGATGAACCTATAAAAATAAATAACAAATAATGTCCA
GGATAATTGATAATAGATACCTAATCTGAGAAATATAAAAAAGCGATTGATAAGCGTAAT
TAACTATCAAATATAGTTAAGTAAGATGTTGAAAAAATAAGCAAAGTCTTTAGATATTCA
GAATAAGATTTTAAATAAAGAGAAAGAGGATAGTTCTTTGAGTATCAATATTGCATGGAT
TCAAGAAATTAAATAAGACCTTAAGATGCGATCAATAATTTTTTCTAAATTGCTACTGAT
GGTAGCCAAATTGATGGATTTGTTATTTATTTCAGTGGCTAAATTACTGAGGGAGTTCCT
TGCATGGCTTTTTAAATAAGAAATGAAGTTCATTTCGTAACTGTTCATTAAATTTTAGAA
TTATGGAGAAAATTCTTGAATGGATACAGAGAAAAGAAGCACTTGTTTTTAATTATTGAG
TCCCCTTGTTCCTCATAATTTTTAGATCAAATTCATTAAAGCAAAGAAAGGGTCGATTAG
TACAATGTTAGCTTTTTATTTAGTGAAAGAGAGAAGAGAACAACTCGTTCTTAAATTAAC
AGCTACTTAAAGCAGTATGAAGAATATCAAAAAGTCATCAAATAAAGAGTCAATGATGAG
GACAAAACTCCATAAAACTTCATTTTGAAATAGGATAACGTTTGGAGAATAGAAGATTAT
GCAGGTTGCTCCGGATTTACTGCTGCTCTGTGTGAGCATCTGCTAAATTCACCACCAAAA
AGAATAGAACAATTATATTAGAGCAGAATTGAGTTCTACTTAAATAAGTATGTAGTCTAA
CCTGGGTTCTTTGGCTTTGCTGCGAAGAACTATTTAGATTTTGGATGGTATATGGACATA
AATTACTATAGAATATAGCAACAAAGCTCTATCAATTTTTATGGAATAAAGAGAAGCCAT
TTTAACTTACCAATGGAATAAATCTCAATTGAGCAAGAATAGAATATTTACAAAGGATTT
AACTACTTTGGTTTAGTTAAAAACAAAAAAACTGACGTGCTTATCCATGATCCAATGCTT
TTAAAAAAGTAAAAAGAATTAGAATAATAGACTGAGTTACTAAATGCAAAAATTGAAGAA
AATAAAATCTCTGAAGCTAAAAATGAAGTGAAGTCATATGTTTCTCAGCAGTCAGTTTTA
GAAGATTACAATTTTCAAAGCGGAGATGAGGAAAATAATCTAACAAGAAATTGCAATGGG
TTCTAAATTTATGAAGATGGATCAAAATATATAGGTTAATGGTTTAACAATAAATAAAAC
GGAATAGGAGTAGCCATCTATAAAAATGGAGACAGGTACGAAGGAGAATTCGTAGATGGT
AAATAGTGCGGATAAGGCTACTTGTATACAAAAAGAACTATATACGCAGGCTAGTTTTAT
AATAATATGTATTTTGGAAAAGGTATAGTAATTTGGTGGGCACGCTTGAGAAACAACTGC
TTTGTTGGTAATTTTAATGACAGATAAGCCACAGGTTATGCCTATAGATTAGATAATTCA
AGAGAAACAAAATTATTTGGTATTATTTCTGATAAACATCAATTCAATTAATACTACGAA
GATCATGAATTAAACATGGATGTACCTGAAGAAGAATCTATGTTTAGTTGTAATAAAGAT
GTTTATGAATTTGATTTCAATTATAATAGCCTTGAAATGAAATGCAATTTTAAAAAATAA
TTTAATGAATATTTAGAAAAATAAGAATAATTTAAAAAAAAGGCTGAAGAAAACTTGAAA
ATGTTAATTTTTTAATAAGTCCAACCAAAATAAGAAGTTCCTGGTCTAGATGAATAAGGA
CAATAGTTATAATAGGTAGAAGAATAATAATTTGCTATTCCTGACGTTACTTAACTGCCT
TAATATGAGGAATTTAAAGAGGATCTAAATGATCTCAATCCAGATATGTAAGAAGATAAT
ATTAAACCTTAAGATGTAGAGTTTTTGCTCAAGCACGCTGTCTGTAAAGTAGAAATTCAA
GAGGAAGAAAAAATTTAAAAAGAAGAAAAAACATTAGAAGTTATACAATAGATTGATGAT
ATGCTTGACGATTTTGAAAATATTTAATTATAACCTGTATAAAAAAATCAATAACCATTA
GAGTAAAAAGAAATAAAATAACCACCATAGGAAATAGGTTAATAATAAATTTAAGAAGAA
CAAAAAAATGAAGAAGCTGGAAATCAACAATAAGAAAAAATTTAAATAGAAAGTAAAAAT
GAAAAACAAGAGTAGTTACCTTTACAATAGCCAGAGCAATAAATATAAGAGACTGCAGAA
TAGAAAGCTATTTAGGCTCGTCTTGCTTTAATACCTTTAGTAGCTATGAAAGAATATTAT
AAAAAGCAAGAGGGTATAGATTTATATGTGTCAAATGAAAAAGTTGAGTAAGATATGAGT
CAATAATTTAAATAAAGTATGCTTAATATTGGTCAAGCTGAAAACAATAAATTTATGAAG
ATTAGAATATAAGACGACGCTAACGTTAGCTTTAATAAAACCATTTTAGATGATCAATAA
AAAGAGAAATTTATTAAAAAATTCAAAAAAAATGCTGCCAAAGCATATGGATGCAAACCT
GAAGATATTATTATATTCGGTCTAAGCAAAGGATCTATAAATGTTGAATTCAAATTAAGG
GATGAACTATATATCAAACTAAATGATAGTAACTAAGTTATAGATTTTTTCAAAAATAAA
TGCAATTACAAAGGAGCTGAATTGAGAGTACATAACCTATTAGAATATGCAACTCTAACA
CCTGAAAACTGTGATCCTAGCTTTAACTTTGACTGGTCTAAAGAACCTGAAGGAAAAATT
TCTTATAGAGGAGGTCTTACTATTAAAAATAAGGGATTTAAGAAGTAACACTATATATTC
CCTTCTGGTTGGAAAGGCTTTGGTTTAAATATTTCTAAGTATAAAGATAAAGAATGGATA
GGATATGTTAATGGCAAACCAACTTATAATTCAAAAGAATAATGGATTGTCCTTTATCAC
GGTACATCTATCCAAGGTGTTGAAGGAATTACAAAAGAAGGTTTTAGATTAGGCCAACAT
CATAAATATGCAGGAGCTAAATGCAGGATTACTGGAAAAATTATTGAAAAGAGTAGTAAA
TGCGTGTATTTGACAGATGATGCAAACGTAGCAGGTCGCTATTCAACTCCTTTTGAAATT
AAAGGCAAAGCTTACCAAATGGTATTTTAGTGCAGAGTTAATCCTAAAGTAGTTAGAAGC
CCTAAAGAAAAGCCAGATTACTATATTATAGAAGAAAGTGGTTAACCCTAACAAAACATT
AGACCCTATCGTATTCTTTTGAAAAAGCTGGATGAAAAAGAATATAAGGAATTTTAAGAA
AACCAAGAAAAAATACGCTAAAATTATTAAGATTAAAATGAAGCTCAATATTAACTTTAA
AAGTTATTAAGAGAATAAGAAGAAGAATCTGGTAAAAGAGAAGAAATATAATATTATGTT
GAAAGTAGTGAATCTGATAATGAATCAGAACAAGATAAATTTGAAAACAATAAATTGCTA
AAAAACATATTAAATAATGATTAGCCCAAAAACAAATAAAATAATTAATAACTCAAAAAT
CAATTACACATACCTATGTCTAATTGA


>TTHERM_00621420(protein)
MYQNNDNSYNEVLQDGRMMRMISMLQPLGERRRLRKINYLFLNSDYIADEPIKINNKQCP
GQLIIDTQSEKYKKAIDKRNQLSNIVKQDVEKISKVFRYSEQDFKQRERGQFFEYQYCMD
SRNQIRPQDAINNFFQIATDGSQIDGFVIYFSGQITEGVPCMAFQIRNEVHFVTVHQILE
LWRKFLNGYREKKHLFLIIESPCSSQFLDQIHQSKERVDQYNVSFLFSEREKRTTRSQIN
SYLKQYEEYQKVIKQRVNDEDKTPQNFILKQDNVWRIEDYAGCSGFTAALCEHLLNSPPK
RIEQLYQSRIEFYLNKYVVQPGFFGFAAKNYLDFGWYMDINYYRIQQQSSINFYGIKRSH
FNLPMEQISIEQEQNIYKGFNYFGLVKNKKTDVLIHDPMLLKKQKELEQQTELLNAKIEE
NKISEAKNEVKSYVSQQSVLEDYNFQSGDEENNLTRNCNGFQIYEDGSKYIGQWFNNKQN
GIGVAIYKNGDRYEGEFVDGKQCGQGYLYTKRTIYAGQFYNNMYFGKGIVIWWARLRNNC
FVGNFNDRQATGYAYRLDNSRETKLFGIISDKHQFNQYYEDHELNMDVPEEESMFSCNKD
VYEFDFNYNSLEMKCNFKKQFNEYLEKQEQFKKKAEENLKMLIFQQVQPKQEVPGLDEQG
QQLQQVEEQQFAIPDVTQLPQYEEFKEDLNDLNPDMQEDNIKPQDVEFLLKHAVCKVEIQ
EEEKIQKEEKTLEVIQQIDDMLDDFENIQLQPVQKNQQPLEQKEIKQPPQEIGQQQIQEE
QKNEEAGNQQQEKIQIESKNEKQEQLPLQQPEQQIQETAEQKAIQARLALIPLVAMKEYY
KKQEGIDLYVSNEKVEQDMSQQFKQSMLNIGQAENNKFMKIRIQDDANVSFNKTILDDQQ
KEKFIKKFKKNAAKAYGCKPEDIIIFGLSKGSINVEFKLRDELYIKLNDSNQVIDFFKNK
CNYKGAELRVHNLLEYATLTPENCDPSFNFDWSKEPEGKISYRGGLTIKNKGFKKQHYIF
PSGWKGFGLNISKYKDKEWIGYVNGKPTYNSKEQWIVLYHGTSIQGVEGITKEGFRLGQH
HKYAGAKCRITGKIIEKSSKCVYLTDDANVAGRYSTPFEIKGKAYQMVFQCRVNPKVVRS
PKEKPDYYIIEESGQPQQNIRPYRILLKKLDEKEYKEFQENQEKIRQNYQDQNEAQYQLQ
KLLREQEEESGKREEIQYYVESSESDNESEQDKFENNKLLKNILNNDQPKNKQNNQQLKN
QLHIPMSN


>TTHERM_00621420(gene)
TGTTTTAGTACTTTAAGTATTCGATAGTTTTAAAAGAGAAGCAAACAAACTCAAATTTAT
ATAATTATTAATATAAGTAGTTTATTTGTAAATATAAAAAAAAAAAAAAATACCTTTCTT
ATGTATCAAAATAATGACAATAGTTATAATGAAGTTCTCTAAGATGGAAGAATGATGAGA
ATGATTTCTATGCTTCAGCCTCTTGGAGAAAGACGCAGACTTAGGAAGATTAATTACTTG
TTTCTTAATTCAGACTATATAGCAGATGAACCTATAAAAATAAATAACAAATAATGTCCA
GGATAATTGATAATAGATACCTAATCTGAGAAATATAAAAAAGCGATTGATAAGCGTAAT
TAACTATCAAATATAGTTAAGTAAGATGTTGAAAAAATAAGCAAAGTCTTTAGATATTCA
GAATAAGATTTTAAATAAAGAGAAAGAGGATAGTTCTTTGAGTATCAATATTGCATGGAT
TCAAGAAATTAAATAAGACCTTAAGATGCGATCAATAATTTTTTCTAAATTGCTACTGAT
GGTAGCCAAATTGATGGATTTGTTATTTATTTCAGTGGCTAAATTACTGAGGGAGTTCCT
TGCATGGCTTTTTAAATAAGAAATGAAGTTCATTTCGTAACTGTTCATTAAATTTTAGAA
TTATGGAGAAAATTCTTGAATGGATACAGAGAAAAGAAGCACTTGTTTTTAATTATTGAG
TCCCCTTGTTCCTCATAATTTTTAGATCAAATTCATTAAAGCAAAGAAAGGGTCGATTAG
TACAATGTTAGCTTTTTATTTAGTGAAAGAGAGAAGAGAACAACTCGTTCTTAAATTAAC
AGCTACTTAAAGCAGTATGAAGAATATCAAAAAGTCATCAAATAAAGAGTCAATGATGAG
GACAAAACTCCATAAAACTTCATTTTGAAATAGGATAACGTTTGGAGAATAGAAGATTAT
GCAGGTTGCTCCGGATTTACTGCTGCTCTGTGTGAGCATCTGCTAAATTCACCACCAAAA
AGAATAGAACAATTATATTAGAGCAGAATTGAGTTCTACTTAAATAAGTATGTAGTCTAA
CCTGGGTTCTTTGGCTTTGCTGCGAAGAACTATTTAGATTTTGGATGGTATATGGACATA
AATTACTATAGAATATAGCAACAAAGCTCTATCAATTTTTATGGAATAAAGAGAAGCCAT
TTTAACTTACCAATGGAATAAATCTCAATTGAGCAAGAATAGAATATTTACAAAGGATTT
AACTACTTTGGTTTAGTTAAAAACAAAAAAACTGACGTGCTTATCCATGATCCAATGCTT
TTAAAAAAGTAAAAAGAATTAGAATAATAGACTGAGTTACTAAATGCAAAAATTGAAGAA
AATAAAATCTCTGAAGCTAAAAATGAAGTGAAGTCATATGTTTCTCAGCAGTCAGTTTTA
GAAGATTACAATTTTCAAAGCGGAGATGAGGAAAATAATCTAACAAGAAATTGCAATGGG
TTCTAAATTTATGAAGATGGATCAAAATATATAGGTTAATGGTTTAACAATAAATAAAAC
GGAATAGGAGTAGCCATCTATAAAAATGGAGACAGGTAAATAAAACAAAACTTTTATTTG
TATTTAAAAAGATTAAATTAACAAGCAAAATATTTACAATCAATTAGCTTTAATCCAAAA
AATTTAGAAATAAATATCTCAAAAGCTTTTTTCTTTTTTTAAATTCGTTTCAGCCAACGC
GTATCTGATATCACTAAAGTCTACAAATTTAAAAACAAATCTTTTATCTTCCATTCAATT
AATCAAAATAATCATCAATTATATTTTATTGATTTGCTTATAAAAATTCATTGAATAAGA
AAATTAAGAGTGATCCATCATTGATCGATCTATTTATCTGTCTTAATATTTTGTGGAGAT
TTTATTTCGCTCATCATTATTAATTTGAACATTCCATTTTCAAAATAATTTTTACTCTTT
AATTTTTGTAATAAAAATCTATTTTATTTTTAAAATTTCTCTCCTTGCTTTTTGATAATT
TAATGAAAATATTTTTTTAAAATTTATTTTACTTAAAATTTTAATATGCTGAATAAATAA
ATATAAAAATATTATCAATTATTTATAAATTTTGTTTGATAATTTTTATGATAAAGTTAG
CTACAAATAATAAAACATATATTTTTAATTTACTTAGGTACGAAGGAGAATTCGTAGATG
GTAAATAGTGCGGATAAGGCTACTTGTATACAAAAAGAACTATATACGCAGGCTAGTTTT
ATAATAATATGTATTTTGGAAAAGGTATAGTAATTTGGTGGGCACGCTTGAGAAACAACT
GCTTTGTTGGTAATTTTAATGACAGATAAGCCACAGGTTATGCCTATAGATTAGATAATT
CAAGAGAAACAAAATTATTTGGTATTATTTCTGATAAACATCAATTCAATTAATACTACG
AAGATCATGAATTAAACATGGATGTACCTGAAGAAGAATCTATGTTTAGTTGTAATAAAG
ATGTTTATGAATTTGATTTCAATTATAATAGCCTTGAAATGAAATGCAATTTTAAAAAAT
AATTTAATGAATATTTAGAAAAATAAGAATAATTTAAAAAAAAGGCTGAAGAAAACTTGA
AAATGTTAATTTTTTAATAAGTCCAACCAAAATAAGAAGTTCCTGGTCTAGATGAATAAG
GACAATAGTTATAATAGGTAGAAGAATAATAATTTGCTATTCCTGACGTTACTTAACTGC
CTTAATATGAGGAATTTAAAGAGGATCTAAATGATCTCAATCCAGATATGTAAGAAGATA
ATATTAAACCTTAAGATGTAGAGTTTTTGCTCAAGCACGCTGTCTGTAAAGTAGAAATTC
AAGAGGAAGAAAAAATTTAAAAAGAAGAAAAAACATTAGAAGTTATACAATAGATTGATG
ATATGCTTGACGATTTTGAAAATATTTAATTATAACCTGTATAAAAAAATCAATAACCAT
TAGAGTAAAAAGAAATAAAATAACCACCATAGGAAATAGGTTAATAATAAATTTAAGAAG
AACAAAAAAATGAAGAAGCTGGAAATCAACAATAAGAAAAAATTTAAATAGAAAGTAAAA
ATGAAAAACAAGAGTAGTTACCTTTACAATAGCCAGAGCAATAAATATAAGAGACTGCAG
AATAGAAAGCTATTTAGGCTCGTCTTGCTTTAATACCTTTAGTAGCTATGAAAGAATATT
ATAAAAAGCAAGAGGGTATAGATTTATATGTGTCAAATGAAAAAGTTGAGTAAGATATGA
GTCAATAATTTAAATAAAGTATGCTTAATATTGGTCAAGCTGAAAACAATAAATTTATGA
AGATTAGAATATAAGACGACGCTAACGTTAGCTTTAATAAAACCATTTTAGATGATCAAT
AAAAAGAGAAATTTATTAAAAAATTCAAAAAAAATGCTGCCAAAGCATATGGATGCAAAC
CTGAAGATATTATTATATTCGGTCTAAGCAAAGGATCTATAAATGTTGAATTCAAATTAA
GGGATGAACTATATATCAAACTAAATGATAGTAACTAAGTTATAGATTTTTTCAAAAATA
AATGCAATTACAAAGGAGCTGAATTGAGAGTACATAACCTATTAGAATATGCAACTCTAA
CACCTGAAAACTGTGATCCTAGCTTTAACTTTGACTGGTCTAAAGAACCTGAAGGAAAAA
TTTCTTATAGAGGAGGTCTTACTATTAAAAATAAGGGATTTAAGAAGTAACACTATATAT
TCCCTTCTGGTTGGAAAGGCTTTGGTTTAAATATTTCTAAGTATAAAGATAAAGAATGGA
TAGGATATGTTAATGGCAAACCAACTTATAATTCAAAAGAATAATGGATTGTCCTTTATC
ACGGTACATCTATCCAAGGTGTTGAAGGAATTACAAAAGAAGGTTTTAGATTAGGCCAAC
ATCATAAATATGCAGGAGCTAAATGCAGGATTACTGGAAAAATTATTGAAAAGAGTAGTA
AATGCGTGTATTTGACAGATGATGCAAACGTAGCAGGTCGCTATTCAACTCCTTTTGAAA
TTAAAGGCAAAGCTTACCAAATGGTATTTTAGTGCAGAGTTAATCCTAAAGTAGTTAGAA
GCCCTAAAGAAAAGCCAGATTACTATATTATAGAAGAAAGTGGTTAACCCTAACAAAACA
TTAGACCCTATCGTATTCTTTTGAAAAAGCTGGATGAAAAAGAATATAAGGAATTTTAAG
AAAACCAAGAAAAAATACGCTAAAATTATTAAGATTAAAATGAAGCTCAATATTAACTTT
AAAAGTTATTAAGAGAATAAGAAGAAGAATCTGGTAAAAGAGAAGAAATATAATATTATG
TTGAAAGTAGTGAATCTGATAATGAATCAGAACAAGATAAATTTGAAAACAATAAATTGC
TAAAAAACATATTAAATAATGATTAGCCCAAAAACAAATAAAATAATTAATAACTCAAAA
ATCAATTACACATACCTATGTCTAATTGA