Identifiers and Description

Gene Model Identifier

TTHERM_00424710

Standard Name

MRNO08 (Membrane Occupation and Recognition Nexus protein other)

Aliases

PreTt14005 | 47.m00200

Description

Protein with predicted MORN domains localized throughout the protein and/or associated with other domains having a predicted function

Genome Browser (Macronucleus)

GBrowse

Genome Browser (Micronucleus)

GBrowse

Gene Ontology Annotations

No Data fetched for Gene Ontology Annotations

Domains

  • ( PF02493 ) MORN repeat
  • ( PF07661 ) MORN repeat variant
  • ( PF01290 ) Thymosin beta-4 family
  • ( PF04914 ) DltD C-terminal region
  • ( PF03832 ) Protein kinase A anchor
  • ( TIGR01442 ) small, acid-soluble spore protein, gamma-type

Gene Expression Profile

  • Tetrahymena Functional Genomics Database:

Change in Gene Expression

TMHMM

TMHMM

Signal Peptide

Signal Peptide Present?: No
Presense Probability: 11.2%

TetraMine Data

TTHERM_00424710

WebApollo

Fullscreen View

Tetrahymena Stock Center

No Data fetched for StockID

Homologs (v.2006 protein sequences)

SourceIdentifierScoreDescription
Tetrahymena borealisEI9_00216.19.997093137033517e-262DNA polymerase catalytic subun
it (3569 aa)
DictyBaseDDB_G02860310.000000000010004361180063202ubqP on chromosome: 4 position
3971817 to 3972755
OxytrichaContig22122.0.g350.00000000002000577768187062MORN repeat

General Information

No Data fetched for General Information

Associated Literature

No Data fetched for Associated Literature

Sequences

>TTHERM_00424710(coding)
ATGATTGAACCATAAAGAAATGTAGAAAATGCACTTTTTGATGATTTTAGAATGTCAAGA
ATGGTATCTATGCTTCAGCCATTAGGAAAGAGGCGTAGGCTCAAAAAAGTGAAATATTTG
TGTCTTAATTCAGACTTTATGACTACATAAATTATTGAAGACATTAATAATATTGAATTT
ATTACGATTGACACAAATTCTGTAGAATACAGATAAATGATTCAAACCCGCAGTAAAAAA
TCAAACAGAGTGAAGCAAAATGTTTAAAAAATATCAAAAGTGTTTGGTTATTGTGAAATT
TCTAGCAGAATTTCTTAGAATGAAAATGTTTCTATCTCTACTTCTTAATATTATTTAGAT
GTCTAAAATGAAAGCAAGCCATTAGAAGTTATAAATAATTTTTTTATGTAAAACTCAGAA
AATGAGGCTGATGGGTTTGTAATTTACTTTAGCGGCGTAATAACTAAAGGAGTACCTTGC
ATGGGTTTTTAAATAAAAGAAAAAGTTTATGTTATAACTATCCATCACATAATCAAAGCA
TGGAAAAGATTTTTAAAAGGGTTCAAACACAAAAAATAGTTACTTTTAATTATTGAATCA
CCTTAAGCAGCATAGTTTTTAGATTCAATTTAAAAATGCAAATCTCATATGCATCACTAT
AATATCAGCTTTTTAATAAGCGACAAAGAAAAGAGACTAAATAGTGAGTTTGATCATTCT
TTTTAAGGTTAGAACACAATTCCTTCAAACTCTAATTATAGATAAGATGAAGTTTGGAAA
ATCAATGATTATGCTTAGTGCTCAGGGTTTACAGCTGCTCTCTGTGAATATCTACTCAAC
TCTCCTCCTGAGAGAATAAAACAACTTTATTAATTGAAAGAAAAATTCTACTCTAATAGA
TATAATGTTCAGCCTGGATTTTTCGGTTATTCTATGAAGAGCTACTTAGACTTTGGGTGG
TTTTTGGATATTAATTATGATAAAATATACTAACAGAGTTGTATTAACTATTTTGGCATA
AATTAAAGAGACTACTCCTAGAGTATGGAACAAATTTCAAAATAGCAAGACAATATTGTT
TACTAAGGATTTGATTACACTGGCTTCATAAAAGACGAAACTACAAAAAATCTCTTATCA
GACCCGTAGCTAATAGAAAAAGAGAAAAAACAAGGTAGCTTATCTAGTTTACTAAGTCTC
AACAGTATAGACTAAGATTAATTGTAATTTAATCTGCAACACTAAAATTCAGATTATTTT
TAAAGTAATACATTTCCTGCAACAAATGATTAAAACAAAATATCTAGATTTTTAAATGGA
TTTTAGATTTACTCTAATGTAGTAAAATATATTGGGCAGTGGCTAAATAACAAGTAACAT
GGAGTTGGAATTGCATTGTATGAGAATGGAACCAGATACGAAGGAGAGTTTGTTGATGGT
AAGCAGTAAGGTTCTGGTTATTTGTATAACTACTAAAGATAAAATATATACGCTGGCTAA
TTTTACAAAGATATGTTTTTTGGAAAGGGTCTAGTTATTTGGTTGACTCGAGACACAAGA
GTAGGATTTCTTGGGAATTTTAATGATAAATAAGGAACTGGCGTTCTCATTGAATTAAGT
GAATTTGGTGAAACTTTAAGAGAAAAAAAAGGCATTATTTCAGATAGGGAGGAATTTAAA
AATAATTTTTAAGATCATGAAGAAATCTTGGAAATTCCTGAAGAGAATGAATCTATGTTC
AGCTCTGTCAAAGACCCGAGCTGGTATGAAGTTTTTTATAAAGAGAATCGTATTGATTAT
AAATGCTCTTTCAAAAAATAATTTGAAGAGCATCAAAAGAAAAAAGAAAAAAGAAAATAA
AAAGCAGAAGAAGTTATTAAACTGCTTTTTTTTAAAAATAATCAATAAAATAATGAAATA
CCTAATTCTCCTATTTCTCCTTAGACTTAACAAAATGTTAATCAACCAATTGTAATCTCA
GACGTGGCTGAACTTCCTTAGTATGAAGAACTGAAGAAAGATTTAAACGAATTGAATCCA
GATTTAGATAACGAAAATATTAAGGCTGATGATGTTGAGTTTTTAGTAAAGCATGCAGTT
TGCAAAGTAGAAATGAAAAAAGAGGAGATTGAAGAGAAAAATCAGAAGACAGAAGAAATT
GAACAAAATTTAAATTCACTCTTTTAAGATTTTGATAATATTAAATTAACAGCTGAGCAA
ACACCATTATCAAGAACAATTACTACTTAAGTTACATCATTCAGTTAAGCTGATTAAGAA
TAAAATCAAGCTGTTAATTTAAACTAAAATAATAATTAATAACAGTAGTAACCACAGTTA
ACAAATCAGCACTCTGAATAAAATAAAAAACTTTCTTCTTTGATACCTTTGATTGCTATG
AAATAAGTTTATTAGCAACAAGGAGTAAAAGTATTTGTGTCTGATTAAAAGATAGAACAA
GATGTTACTCAATAATATAAATAAAGTTAGCTTCAAATAGGTCAAACTTCGAATACCTCA
TATATGAAACTAAAAATATAGGATAATGAAAAAATTAACTTTGACAATTCAATTTTAAGC
GATCAGAAGGAAGAGTTTATTAAATAATTAAAAGAAAATCTTGCCAAAGCTCATGGATGC
GAAGCAAAATAAATAGTTATTGTTGCTTTAAATAAAGGTTCTATAGAGGCTGAATATAAA
TTTAAAGATGAAAATGCTTGTACTAAAAATAAAATGTAAGCTATGGAGTATTTAAGAAAT
GAATGCAATTATAAAGGTGCTAACTTAGAAATGCAAAACCTGCTAGATATGGCTACTCTA
ACACCAGAGGATATTTATCAACCTTTTAATAGTGAGTGGAATGTTAAAAAATTAGCTTAC
AGAGGTTTCATTAAGTTCCATCATAACAATTAATATTAAAAATTTCGTTATAACCTTCCA
GTAGGATGGAAAGGTTTTGGTTTAAATATTTTTAAATATAATGATAGAGATTGGTTAGGA
AATTTTGGAAACAGAAAAGATTATGATGAGAAAAAGTAATGGATTCCGCTTTATCACGGT
ACTAATATCCATGCTATAAAAGGTATAAAAAAGGATGGATTTAAGTCAGGCTCTCATCAC
AAATATGCTGGTGCTACATGTAGAATTACTGGAAAAATCATAGATAAGAGTAGTAATTGT
GTTTATTTAACTGATAATGCAGACATAGCAGGATCATATTCAACACCGTTTGAGATTGGT
GGATAAGCCTTTAAGATGGTATTTTAATGCAGAGTCAATCCAGAAAAAGTTAAAAGTCCA
AAAGATAAACCTGATTATTACATTGTAGAAGAAGATGATAAGCCCCAATTAAATATTAGA
CCTTATCGTATTCTTTTGAAGAAATTAACTGAAGAAGAATATAATGAATTTAAGAAACTA
TAATAAGAAGTACAAAATAATTAAACTGATGGTGATAAAGATCAATAGTTAAAAGATTAA
ATTATGTATTAAGCAGAAGAAATTGGGAATAGAGATTAAATAGAACATTAATAATGCAGT
AGTGAAAGTGATGATTCAGAGAATAAATCAAACTAGGATAAATCTGAGTGA


>TTHERM_00424710(protein)
MIEPQRNVENALFDDFRMSRMVSMLQPLGKRRRLKKVKYLCLNSDFMTTQIIEDINNIEF
ITIDTNSVEYRQMIQTRSKKSNRVKQNVQKISKVFGYCEISSRISQNENVSISTSQYYLD
VQNESKPLEVINNFFMQNSENEADGFVIYFSGVITKGVPCMGFQIKEKVYVITIHHIIKA
WKRFLKGFKHKKQLLLIIESPQAAQFLDSIQKCKSHMHHYNISFLISDKEKRLNSEFDHS
FQGQNTIPSNSNYRQDEVWKINDYAQCSGFTAALCEYLLNSPPERIKQLYQLKEKFYSNR
YNVQPGFFGYSMKSYLDFGWFLDINYDKIYQQSCINYFGINQRDYSQSMEQISKQQDNIV
YQGFDYTGFIKDETTKNLLSDPQLIEKEKKQGSLSSLLSLNSIDQDQLQFNLQHQNSDYF
QSNTFPATNDQNKISRFLNGFQIYSNVVKYIGQWLNNKQHGVGIALYENGTRYEGEFVDG
KQQGSGYLYNYQRQNIYAGQFYKDMFFGKGLVIWLTRDTRVGFLGNFNDKQGTGVLIELS
EFGETLREKKGIISDREEFKNNFQDHEEILEIPEENESMFSSVKDPSWYEVFYKENRIDY
KCSFKKQFEEHQKKKEKRKQKAEEVIKLLFFKNNQQNNEIPNSPISPQTQQNVNQPIVIS
DVAELPQYEELKKDLNELNPDLDNENIKADDVEFLVKHAVCKVEMKKEEIEEKNQKTEEI
EQNLNSLFQDFDNIKLTAEQTPLSRTITTQVTSFSQADQEQNQAVNLNQNNNQQQQQPQL
TNQHSEQNKKLSSLIPLIAMKQVYQQQGVKVFVSDQKIEQDVTQQYKQSQLQIGQTSNTS
YMKLKIQDNEKINFDNSILSDQKEEFIKQLKENLAKAHGCEAKQIVIVALNKGSIEAEYK
FKDENACTKNKMQAMEYLRNECNYKGANLEMQNLLDMATLTPEDIYQPFNSEWNVKKLAY
RGFIKFHHNNQYQKFRYNLPVGWKGFGLNIFKYNDRDWLGNFGNRKDYDEKKQWIPLYHG
TNIHAIKGIKKDGFKSGSHHKYAGATCRITGKIIDKSSNCVYLTDNADIAGSYSTPFEIG
GQAFKMVFQCRVNPEKVKSPKDKPDYYIVEEDDKPQLNIRPYRILLKKLTEEEYNEFKKL
QQEVQNNQTDGDKDQQLKDQIMYQAEEIGNRDQIEHQQCSSESDDSENKSNQDKSE


>TTHERM_00424710(gene)
ATGATTGAACCATAAAGAAATGTAGAAAATGCACTTTTTGATGATTTTAGAATGTCAAGA
ATGGTATCTATGCTTCAGCCATTAGGAAAGAGGCGTAGGCTCAAAAAAGTGAAATATTTG
TGTCTTAATTCAGACTTTATGACTACATAAATTATTGAAGACATTAATAATATTGAATTT
ATTACGATTGACACAAATTCTGTAGAATACAGATAAATGATTCAAACCCGCAGTAAAAAA
TCAAACAGAGTGAAGCAAAATGTTTAAAAAATATCAAAAGTGTTTGGTTATTGTGAAATT
TCTAGCAGAATTTCTTAGAATGAAAATGTTTCTATCTCTACTTCTTAATATTATTTAGAT
GTCTAAAATGAAAGCAAGCCATTAGAAGTTATAAATAATTTTTTTATGTAAAACTCAGAA
AATGAGGCTGATGGGTTTGTAATTTACTTTAGCGGCGTAATAACTAAAGGAGTACCTTGC
ATGGGTTTTTAAATAAAAGAAAAAGTTTATGTTATAACTATCCATCACATAATCAAAGCA
TGGAAAAGATTTTTAAAAGGGTTCAAACACAAAAAATAGTTACTTTTAATTATTGAATCA
CCTTAAGCAGCATAGTTTTTAGATTCAATTTAAAAATGCAAATCTCATATGCATCACTAT
AATATCAGCTTTTTAATAAGCGACAAAGAAAAGAGACTAAATAGTGAGTTTGATCATTCT
TTTTAAGGTTAGAACACAATTCCTTCAAACTCTAATTATAGATAAGATGAAGTTTGGAAA
ATCAATGATTATGCTTAGTGCTCAGGGTTTACAGCTGCTCTCTGTGAATATCTACTCAAC
TCTCCTCCTGAGAGAATAAAACAACTTTATTAATTGAAAGAAAAATTCTACTCTAATAGA
TATAATGTTCAGCCTGGATTTTTCGGTTATTCTATGAAGAGCTACTTAGACTTTGGGTGG
TTTTTGGATATTAATTATGATAAAATATACTAACAGAGTTGTATTAACTATTTTGGCATA
AATTAAAGAGACTACTCCTAGAGTATGGAACAAATTTCAAAATAGCAAGACAATATTGTT
TACTAAGGATTTGATTACACTGGCTTCATAAAAGACGAAACTACAAAAAATCTCTTATCA
GACCCGTAGCTAATAGAAAAAGAGAAAAAACAAGGTAGCTTATCTAGTTTACTAAGTCTC
AACAGTATAGACTAAGATTAATTGTAATTTAATCTGCAACACTAAAATTCAGATTATTTT
TAAAGTAATACATTTCCTGCAACAAATGATTAAAACAAAATATCTAGATTTTTAAATGGA
TTTTAGATTTACTCTAATGTAGTAAAATATATTGGGCAGTGGCTAAATAACAAGTAACAT
GGAGTTGGAATTGCATTGTATGAGAATGGAACCAGGTAAATTATAATTTTTCATTTCAAA
TTAAAATTAAACATTTGATTAAAATTGATTAAAATTATTTATTTATTTATTTATCTTGCA
GATAAAGAAAAACAAATTTCTTAAAAGAGTATTTTTTGAAATTGCGAATTAATTTGCTTT
TTGTGGAATTTTCAACTCAACAAAAAATCACAAATCTAATTACATTATTTTTATTTTATT
GAACAAAATTCACAATAAATTAATAAATAATCCAAATTTAAATATTCTTAGATACGAAGG
AGAGTTTGTTGATGGTAAGCAGTAAGGTTCTGGTTATTTGTATAACTACTAAAGATAAAA
TATATACGCTGGCTAATTTTACAAAGATATGTTTTTTGGAAAGGGTCTAGTTATTTGGTT
GACTCGAGACACAAGAGTAGGATTTCTTGGGAATTTTAATGATAAATAAGGAACTGGCGT
TCTCATTGAATTAAGTGAATTTGGTGAAACTTTAAGAGAAAAAAAAGGCATTATTTCAGA
TAGGGAGGAATTTAAAAATAATTTTTAAGATCATGAAGAAATCTTGGAAATTCCTGAAGA
GAATGAATCTATGTTCAGCTCTGTCAAAGACCCGAGCTGGTATGAAGTTTTTTATAAAGA
GAATCGTATTGATTATAAATGCTCTTTCAAAAAATAATTTGAAGAGCATCAAAAGAAAAA
AGAAAAAAGAAAATAAAAAGCAGAAGAAGTTATTAAACTGCTTTTTTTTAAAAATAATCA
ATAAAATAATGAAATACCTAATTCTCCTATTTCTCCTTAGACTTAACAAAATGTTAATCA
ACCAATTGTAATCTCAGACGTGGCTGAACTTCCTTAGTATGAAGAACTGAAGAAAGATTT
AAACGAATTGAATCCAGATTTAGATAACGAAAATATTAAGGCTGATGATGTTGAGTTTTT
AGTAAAGCATGCAGTTTGCAAAGTAGAAATGAAAAAAGAGGAGATTGAAGAGAAAAATCA
GAAGACAGAAGAAATTGAACAAAATTTAAATTCACTCTTTTAAGATTTTGATAATATTAA
ATTAACAGCTGAGCAAACACCATTATCAAGAACAATTACTACTTAAGTTACATCATTCAG
TTAAGCTGATTAAGAATAAAATCAAGCTGTTAATTTAAACTAAAATAATAATTAATAACA
GTAGTAACCACAGTTAACAAATCAGCACTCTGAATAAAATAAAAAACTTTCTTCTTTGAT
ACCTTTGATTGCTATGAAATAAGTTTATTAGCAACAAGGAGTAAAAGTATTTGTGTCTGA
TTAAAAGATAGAACAAGATGTTACTCAATAATATAAATAAAGTTAGCTTCAAATAGGTCA
AACTTCGAATACCTCATATATGAAACTAAAAATATAGGATAATGAAAAAATTAACTTTGA
CAATTCAATTTTAAGCGATCAGAAGGAAGAGTTTATTAAATAATTAAAAGAAAATCTTGC
CAAAGCTCATGGATGCGAAGCAAAATAAATAGTTATTGTTGCTTTAAATAAAGGTTCTAT
AGAGGCTGAATATAAATTTAAAGATGAAAATGCTTGTACTAAAAATAAAATGTAAGCTAT
GGAGTATTTAAGAAATGAATGCAATTATAAAGGTGCTAACTTAGAAATGCAAAACCTGCT
AGATATGGCTACTCTAACACCAGAGGATATTTATCAACCTTTTAATAGTGAGTGGAATGT
TAAAAAATTAGCTTACAGAGGTTTCATTAAGTTCCATCATAACAATTAATATTAAAAATT
TCGTTATAACCTTCCAGTAGGATGGAAAGGTTTTGGTTTAAATATTTTTAAATATAATGA
TAGAGATTGGTTAGGAAATTTTGGAAACAGAAAAGATTATGATGAGAAAAAGTAATGGAT
TCCGCTTTATCACGGTACTAATATCCATGCTATAAAAGGTATAAAAAAGGATGGATTTAA
GTCAGGCTCTCATCACAAATATGCTGGTGCTACATGTAGAATTACTGGAAAAATCATAGA
TAAGAGTAGTAATTGTGTTTATTTAACTGATAATGCAGACATAGCAGGATCATATTCAAC
ACCGTTTGAGATTGGTGGATAAGCCTTTAAGATGGTATTTTAATGCAGAGTCAATCCAGA
AAAAGTTAAAAGTCCAAAAGATAAACCTGATTATTACATTGTAGAAGAAGATGATAAGCC
CCAATTAAATATTAGACCTTATCGTATTCTTTTGAAGAAATTAACTGAAGAAGAATATAA
TGAATTTAAGAAACTATAATAAGAAGTACAAAATAATTAAACTGATGGTGATAAAGATCA
ATAGTTAAAAGATTAAATTATGTATTAAGCAGAAGAAATTGGGAATAGAGATTAAATAGA
ACATTAATAATGCAGTAGTGAAAGTGATGATTCAGAGAATAAATCAAACTAGGATAAATC
TGAGTGA