Identifiers and Description

Gene Model Identifier

TTHERM_00334450

Standard Name

MRNO07 (Membrane Occupation and Recognition Nexus protein other)

Aliases

PreTt05990 | 34.m00227 | 3689.m00025

Description

Protein with predicted MORN domains localized throughout the protein and/or associated with other domains having a predicted function. Protein kinase domain containing protein.

Genome Browser (Macronucleus)

GBrowse

Genome Browser (Micronucleus)

GBrowse

Gene Ontology Annotations

Molecular Function

Biological Process

Domains

Gene Expression Profile

  • Tetrahymena Functional Genomics Database:

Change in Gene Expression

TMHMM

TMHMM

Signal Peptide

Signal Peptide Present?: No
Presense Probability: 15.5%

TetraMine Data

TTHERM_00334450

WebApollo

Fullscreen View

Tetrahymena Stock Center

No Data fetched for StockID

Homologs (v.2006 protein sequences)

SourceIdentifierScoreDescription
Tetrahymena borealisEI9_16038.19.997093137033517e-262MORN repeat variant family pro
tein (919 aa)
OxytrichaContig9312.0.g77.9993595954329e-16Protein kinase domain
WormBaseWBGene000022100.000000030002053728821195locus:kin-29 Serine/threonin
e-protein kinase kin-29 stat
us:Confirmed UniProt:Q21017
protein_id:CCD71675.1
SGDYGL179C0.000005998506718272351TOS3 Protein kinase, related t
o and functionally redundant w
ith Elm1p and Sak1p for the ph
osphorylation and activation o
f Snf1p; functionally ortholog
ous to LKB1, a mammalian kinas
e associated with Peutz-Jegher
s cancer-susceptibility syndro
me

General Information

No Data fetched for General Information

Associated Literature

No Data fetched for Associated Literature

Sequences

>TTHERM_00334450(coding)
ATGGAAGGAATATCTAAAGAGGAGCTTCGTATCCAATACGATAGTCTAGAAAATAAACCT
CAAATGGGTTTTCAAATTCTACTTTCAAATATTTACTTTCTTCTAACCAAAGGCATAGTC
ACGAACTAAATAATAGGATCAAGTGGCAATTCATTTATGCTTAAGTGCAACTAAAAGACA
CCAAATGGTATTATTATTTTAACTGTCAGGGCTATTATGGTTAACAGCTATAGTACTCTT
TCAAATGCTGTTGAGTTATATGAGAATTAGGTAGATATAAAATATGTATCAGAATATATT
TAAGTTTATGACTCCTTCTGCTACAATAAAAATGATGAAGTAATGAATTACGTGAGAAGA
GGATTTTATCGCTACACAATTGATGAAATGTACAAGCTGAATTCATCATTCAAAGGCTAA
GGTGTTTTAAACCGCTTTGACCTTATTTAAAAATGGATAGACTAATTGATAGAAGCATTA
TCTTTGCTACATGAAAGAGGACTCTATCACGGTGGTGTTAAGGCATCTAATATCTTTGTA
GATGAAAATAGCAATTAAATACGTATTATTGACTATGGATTTTACTCATCTCATGTAAAT
TTGATGAATTAAAATTACTCTAAAGATGTGTACACTCCATTAGTCTTTAATGAGCTTGCA
AATTCATTCGATTAGAAGAGGTTTAATGATATTTATGCTTTAATTATTTTAATCTATCAA
ATGGCTTTTGGCTTTGATAACTCCCATTACTAGATAAAATAGCTTTAAAAAGGAATAACA
TTTAACGATGAGGATGATGGAAGAGATCACGAATCAGATGATACTTACGAATTTAAGTTA
AGGATAATTAAGCTTGTTAATAAAATAGTTTGTAAAGCAGCTCTAGGAACAGAAGAATAA
CGCAAAAAGATTACCTTATTCTATGTCTCAGATGTGCTTTAATAAAAAAGAAATGTAGAA
TCTTTCTAAAATTCTCCTAAACACATAGCTGAAACTCTATAAGTATTTGATAATGGTTAA
AAAGTGGTTATTTCAAGTGAAAGAGTTTTAGCTGCTGCATAACCATAATAATAAAATTAT
GATGGCGACTCTAAGACAGATTATACCCAAGAAGAGCTCTATCTATAAGAAATGATTTAT
TAATAACAAAAGTAGCATGAATAAGAACAAAAATAAATATAGTAGTAAATTTATTCGAAT
GAAAATTTAACTTTATAACAAAAAATAGACGTTTACAAAAAGTTAGACTATGAAAAATAT
TAACACAGTAGCTCTTAAAATAGTACATCTAATATCCTAAGTCCAGAGAAAAATTAAGCA
GTAATAAGCCCTCTATTTTAAGTAAATTAGAGTCATCAGCTTATGAGTGAAATTTAAGAA
TAATAAGTTAAAATCGAAAATTATGAAAAGGAAAAATAATATATCAATCCAGTCGAATAA
GAATAAAAACTTGATTAAATTTTGTAAATGCATAGATAAGAAAAAGATTTGATAATTAAT
TAACAAAATTCTGATTAAATAAATTCTACAGCACTGGACAAATAAAATTCTAATTTGGTT
CAAGGCTTCCTTTAAGATAATAAAATCATAAAATCATGTTTTGATTTTAATTCTCCAATA
AATACATAACCTACTTCAATTTCTTAACATATACGCACATACTCGAGTGCTGTTTATGAT
CACGCACCTAATTCTGCTCAAATTGTTGAAAATCCAGAAAAAATTTAAGTTACACAAGAA
ACCAAACCTGATGAAATAGATACTTAATAGAATAAAATTTTAGAAGAAAAATATGAAGAT
TTTTGGGTGATAGATTTATCTCATAAAAATAGTGTATAAAGAGGAGCAGATTATCATCCT
AGTAAGTACTAAGAATAAATTAAATAAGCTTAATTAAAATAGTAACAAAATGAAATTGAA
GACATTTACACTCAAGTAAATTAGAGATCAAATCAAAAAATGACAATATAATAAACTTTA
CTTAAATAAATTGAATAATTTGATAAATAATAATAATAATAATAGTAATAACAACCAGAA
AAAACAATTTAATAAACAGCATTTTAACAAGATTCTCATAAGGATATTTCTACCAGTTAA
AATTGTGAAATCAAGACACCATACATGAGTACTGAATAAATCTTATCTAACTCCTAAGAA
AACTAAATAATCAGATTTCCAAATGGAGCTATTCAGTATGAAGGTTAGATATAAAGTGGA
TAGAAAAATGGCTATGGAGTACTCTACAACTGTAATGGCACAAAAATGTATGAAGGAAGC
TTTAAAGATGATTTCTATCATGGTTTTGGAATGGAATATTATGAAAATGGTTAAATTCTT
CATTAAGGAAATTTTGAAAAAGGATTATTAAATGGATTTGCTAAAACCTTCTACAAGAAT
GGAAGCCTATGTTACGAAGGAGATTATGTTGAAGGCATATGCCATGGAAATGGCACAAAG
TACGATGAGAGCTCATCAAACTTCTAACAAGGTTAATACTAAAATGGAAAGATGATAGGA
GTTCACAAGAAGTACCAATAAAATGGCTAAATAATATTTGAAACTAATTTTAAAAATAAT
AAAAGAGATGGAAAATCTATTGAGTATCATTAATAAGGTGGTATTAGCTTTGAGGGAACA
TATAAAAACGGTAAGAAAATGAATGGTATTGAATATGACCATGATGGAAATAAAATACAT
GAAGGTGATTATGAATAATACGAATTTTGA


>TTHERM_00334450(protein)
MEGISKEELRIQYDSLENKPQMGFQILLSNIYFLLTKGIVTNQIIGSSGNSFMLKCNQKT
PNGIIILTVRAIMVNSYSTLSNAVELYENQVDIKYVSEYIQVYDSFCYNKNDEVMNYVRR
GFYRYTIDEMYKLNSSFKGQGVLNRFDLIQKWIDQLIEALSLLHERGLYHGGVKASNIFV
DENSNQIRIIDYGFYSSHVNLMNQNYSKDVYTPLVFNELANSFDQKRFNDIYALIILIYQ
MAFGFDNSHYQIKQLQKGITFNDEDDGRDHESDDTYEFKLRIIKLVNKIVCKAALGTEEQ
RKKITLFYVSDVLQQKRNVESFQNSPKHIAETLQVFDNGQKVVISSERVLAAAQPQQQNY
DGDSKTDYTQEELYLQEMIYQQQKQHEQEQKQIQQQIYSNENLTLQQKIDVYKKLDYEKY
QHSSSQNSTSNILSPEKNQAVISPLFQVNQSHQLMSEIQEQQVKIENYEKEKQYINPVEQ
EQKLDQILQMHRQEKDLIINQQNSDQINSTALDKQNSNLVQGFLQDNKIIKSCFDFNSPI
NTQPTSISQHIRTYSSAVYDHAPNSAQIVENPEKIQVTQETKPDEIDTQQNKILEEKYED
FWVIDLSHKNSVQRGADYHPSKYQEQIKQAQLKQQQNEIEDIYTQVNQRSNQKMTIQQTL
LKQIEQFDKQQQQQQQQQPEKTIQQTAFQQDSHKDISTSQNCEIKTPYMSTEQILSNSQE
NQIIRFPNGAIQYEGQIQSGQKNGYGVLYNCNGTKMYEGSFKDDFYHGFGMEYYENGQIL
HQGNFEKGLLNGFAKTFYKNGSLCYEGDYVEGICHGNGTKYDESSSNFQQGQYQNGKMIG
VHKKYQQNGQIIFETNFKNNKRDGKSIEYHQQGGISFEGTYKNGKKMNGIEYDHDGNKIH
EGDYEQYEF


>TTHERM_00334450(gene)
AATAATTAAATAAATTATCAAAAATTTAAAATCAGAGTGTCAAAAATCATAAAACAAACC
ATATCAAATTAATAATTATAAAAGCAATTTTTAAAAGATATGGAAGGAATATCTAAAGAG
GAGCTTCGTATCCAATACGATAGTCTAGAAAATAAACCTCAAATGGGTTTTCAAATTCTA
CTTTCAAATATTTACTTTCTTCTAACCAAAGGCATAGTCACGAACTAAATAATAGGATCA
AGTGGCAATTCATTTATGCTTAAGTGCAACTAAAAGACACCAAATGGTATTATTATTTTA
ACTGTCAGGGCTATTATGGTTAACAGCTATAGTACTCTTTCAAATGCTGTTGAGTTATAT
GAGAATTAGGTAGATATAAAATATGTATCAGAATATATTTAAGTTTATGACTCCTTCTGC
TACAATAAAAATGATGAAGTAATGAATTACGTGAGAAGAGGATTTTATCGCTACACAATT
GATGAAATGTACAAGCTGAATTCATCATTCAAAGGCTAAGGTGTTTTAAACCGCTTTGAC
CTTATTTAAAAATGGATAGACTAATTGATAGAAGCATTATCTTTGCTACATGAAAGAGGA
CTCTATCACGGTGGTGTTAAGGCATCTAATATCTTTGTAGATGAAAATAGCAATTAAATA
CGTATTATTGACTATGGATTTTACTCATCTCATGTAAATTTGATGAATTAAAATTACTCT
AAAGATGTGTACACTCCATTAGTCTTTAATGAGCTTGCAAATTCATTCGATTAGAAGAGG
TTTAATGATATTTATGCTTTAATTATTTTAATCTATCAAATGGCTTTTGGCTTTGATAAC
TCCCATTACTAGATAAAATAGCTTTAAAAAGGAATAACATTTAACGATGAGGATGATGGA
AGAGATCACGAATCAGATGATACTTACGAATTTAAGTTAAGGATAATTAAGCTTGTTAAT
AAAATAGTTTGTAAAGCAGCTCTAGGAACAGAAGAATAACGCAAAAAGATTACCTTATTC
TATGTCTCAGATGTGCTTTAATAAAAAAGAAATGTAGAATCTTTCTAAAATTCTCCTAAA
CACATAGCTGAAACTCTATAAGTATTTGATAATGGTTAAAAAGTGGTTATTTCAAGTGAA
AGAGTTTTAGCTGCTGCATAACCATAATAATAAAATTATGATGGCGACTCTAAGACAGAT
TATACCCAAGAAGAGCTCTATCTATAAGAAATGATTTATTAATAACAAAAGTAGCATGAA
TAAGAACAAAAATAAATATAGTAGTAAATTTATTCGAATGAAAATTTAACTTTATAACAA
AAAATAGACGTTTACAAAAAGTTAGACTATGAAAAATATTAACACAGTAGCTCTTAAAAT
AGTACATCTAATATCCTAAGTCCAGAGAAAAATTAAGCAGTAATAAGCCCTCTATTTTAA
GTAAATTAGAGTCATCAGCTTATGAGTGAAATTTAAGAATAATAAGTTAAAATCGAAAAT
TATGAAAAGGAAAAATAATATATCAATCCAGTCGAATAAGAATAAAAACTTGATTAAATT
TTGTAAATGCATAGATAAGAAAAAGATTTGATAATTAATTAACAAAATTCTGATTAAATA
AATTCTACAGCACTGGACAAATAAAATTCTAATTTGGTTCAAGGCTTCCTTTAAGATAAT
AAAATCATAAAATCATGTTTTGATTTTAATTCTCCAATAAATACATAACCTACTTCAATT
TCTTAACATATACGCACATACTCGAGTGCTGTTTATGATCACGCACCTAATTCTGCTCAA
ATTGTTGAAAATCCAGAAAAAATTTAAGTTACACAAGAAACCAAACCTGATGAAATAGAT
ACTTAATAGAATAAAATTTTAGAAGAAAAATATGAAGATTTTTGGGTGATAGATTTATCT
CATAAAAATAGTGTATAAAGAGGAGCAGATTATCATCCTAGTAAGTACTAAGAATAAATT
AAATAAGCTTAATTAAAATAGTAACAAAATGAAATTGAAGACATTTACACTCAAGTAAAT
TAGAGATCAAATCAAAAAATGACAATATAATAAACTTTACTTAAATAAATTGAATAATTT
GATAAATAATAATAATAATAATAGTAATAACAACCAGAAAAAACAATTTAATAAACAGCA
TTTTAACAAGATTCTCATAAGGATATTTCTACCAGTTAAAATTGTGAAATCAAGACACCA
TACATGAGTACTGAATAAATCTTATCTAACTCCTAAGAAAACTAAATAATCAGATTTCCA
AATGGAGCTATTCAGTATGAAGGTTAGATATAAAGTGGATAGAAAAATGGCTATGGAGTA
CTCTACAACTGTAATGGCACAAAAATGTATGAAGGAAGCTTTAAAGATGATTTCTATCAT
GGTTTTGGAATGGAATATTATGAAAATGGTTAAATTCTTCATTAAGGAAATTTTGAAAAA
GGATTATTAAATGGATTTGCTAAAACCTTCTACAAGAATGGAAGCCTATGTTACGAAGGA
GATTATGTTGAAGGCATATGCCATGGAAATGGCACAAAGTACGATGAGAGCTCATCAAAC
TTCTAACAAGGTTAATACTAAAATGGAAAGATGATAGGAGTTCACAAGAAGTACCAATAA
AATGGCTAAATAATATTTGAAACTAATTTTAAAAATAATAAAAGAGATGGAAAATCTATT
GAGTATCATTAATAAGGTGGTATTAGCTTTGAGGGAACATATAAAAACGGTAAGAAAATG
AATGGTATTGAATATGACCATGATGGAAATAAAATACATGAAGGTGATTATGAATAATAC
GAATTTTGA