Identifiers and Description

Gene Model Identifier

TTHERM_00389810

Standard Name

MRNO06 (Membrane Occupation and Recognition Nexus protein other)

Aliases

PreTt24877 | 41.m00284

Description

Protein with predicted MORN domains localized throughout the protein and/or associated with other domains having a predicted function

Genome Browser (Macronucleus)

GBrowse

Genome Browser (Micronucleus)

GBrowse

Gene Ontology Annotations

No Data fetched for Gene Ontology Annotations

Domains

Gene Expression Profile

  • Tetrahymena Functional Genomics Database:

TetraMine Data

TTHERM_00389810

WebApollo

Fullscreen View

Tetrahymena Stock Center

No Data fetched for StockID

Homologs (v.2006 protein sequences)

SourceIdentifierScoreDescription
Tetrahymena borealisEI9_04511.19.997093137033517e-262hypothetical protein (828 aa)
OxytrichaContig19213.0.g110.00000000039982266684865623MORN repeat
WormBaseWBGene000005180.000000030002053728821195locus:ckk-1 status:Confirmed
UniProt:G5EDZ4 protein_id
:CCD63131.1
DictyBaseDDB_G02744830.0000004998288985444982DDB_G0274483 on chromosome: 2
position 4423293 to 4428420

General Information

No Data fetched for General Information

Associated Literature

No Data fetched for Associated Literature

Sequences

>TTHERM_00389810(coding)
ATGGGAAAATGTATTAGCCACATAACTAGAAAAGATTGGTATAAGAACTGCAACAAGGGT
TGCTTATATTGTTTTGGATATAACTGTGATATGTGTGCAGTTGATTTACAAGATGGATGG
AATAGATGTTGTGATGTTTTGTGCTTTTTTTGTACTTTTAGTTGCTGCTAATGTTAATGT
ACTCTAATCAAAAATTGCTACCATGGAATAATGAATAAAATTGAGCCTTGCTGTAGTGCA
TGTGGTAGACTAAATGATAAATTACTTAAATTTTGCTAAAATGAATGTGATGATATGTGT
GAATGTCATTGCTATTGTGAGAATCCTTGTATAGTTAGGGATGTGAATAACAAATAATTT
CTAGAATACATGTCTGAGTTTAAAATAAAAGTTAATTTTTACAATGATTCAATATTTGGA
GAAGCGTGTATCCTTTAGAAATAATCTACAGGAGAATTGTTTACTGTGAAAGTAATTTAA
TACAATAATGAAAACAAATTTTTGTAAGGAGATTAATAATTTAAAAGAAGACTGCAAATA
TTTCATCCAAATATTGTTAATTTAAAACATGTTGAAAGCTTCACTGAAGATTCATTTTGT
AGTTTAAGAATTAAAAATTTTCTATTTTTTGATTTTGTATTAATGGATTTATAAACTGAG
ATCAATTATCGAAAAAAGACAAATTGTTTTTTCAAAGAAGAGGAGCTTTGGAATTTAATT
GAAGGAACTTTACAAGCTTTGTACTACTTTTATGAAATTAAATTGGAGCATCAAGGTATA
AGAGCTGATAGAATATATGTTAGTTAATTAGGCTAATTTAAAATAGCAGATCCTTATTTA
CTCTAAAGCTCTAATAATTTCGATGATGTTAAAGAAGCATACTTTTAATCTGATACCATA
TCTGAAAATATTTTCTTATCGCCTGACTAATTTTATAAAATAACTTAAGATGATGAATAT
AAAGCTTCTAATAAATACGAAAATAGATTTAAATCTGATATATTTTCTCTAGGAATGATT
TTTCTATGTGCAGCATCTCTTGAAAATTTAGCTTCGTTGTATAACTTTGAAGATAGTTGT
ATCGATTTGCACAGTCTCAACTTTAAAATAGAAAATACAGCATCAAGGTATAAGTCCTAA
ATTTTAGGAAGACTATTGTTAGGGATGCTTGAAGAAAATTAAGACAAGAGATTAGATGCT
AAAAAAGCGCTTTTACTTATTCAAACTGAAGACAAAGTTAAGTAATGTATAATAGAATCT
AGGACAAATCAGTAATAATAAGGCCTAAAAGATCTATAAACACCAATAAAATAAAGGAGC
TTGAGTGTTATAAACGAGATACTGGAGAATGATAACTTCCATTTTTAAAATATTGGAAAC
AATTCTTTTGAAGATAAGATTTCGAATCCTCTGGAAATGTCGAGAGGAGGAGGTGGTACA
ACTTCAAATAAATAAATAACTATTCAGAGTATGTAGACACCAGTAATGAGAAATTAGACA
ATCAAGCAATTTAGCCCTTATAAATAAGAATCTGAATAGGTACTTAAAAGTTTTTATAAT
TTAGAGTACAAAAAAATAGTTGATGGTCAAATCCTTAATTTTTAATTTACTGGCCTAGGT
GAAGATTCAGAATAAATTTAGCTGTCTGATTTGGGAACTATAGCTGTAAATAATACTTAA
AAAACTCTTTTAGAGAGATTGTGGGTTTAGTGTAAAGAAAGCAAATTCATTCAAAAAGTG
AATTGTTTTAAGAAAAAAAAATAAATTTCAGAACTGTCTCTATCATAAGTAAAATTTGGA
ATCTTATTCAATGAGAATAGAGATATAATTTACGAGGGAAACCTCTATGAAGAAAATATC
AAGCATGGGGAAGGAAAGTTGTTTGAAGGAAGCTAGATATATATAGGAAATTTTAGTTTT
GATAAAAAAGATGGCATTGGTAAAATTACTGACTTGCAAGGACATGTTTTATTTGAAGGG
AGTTTTGTGAATGATAAAAAAGAAGGTTAAGGAATAGAATATAATATGACTTATGATGAA
AATTAGCTTATACATTTTAAAAATTTCCATAAAAACTGGAAAAAATTTGAGGGCTAGTAC
TCAAACAGTAAAAAAAATGGTGAAGGAATTTACACTTATCATAACAATCATAAATTTAAG
TGTAATTTTATAAACAATTTTGCTGATGGAGAAGGGGTTTATTTAAATGAATAAGATTAA
GTACTTTTTAAAGCTATTTATAAAAAAAACAAAATTTAAAGAGTTATTTAAAACTTTTCT
TTATATCCTCAACCATTATCTACAGGTGGAGGACTTTCTCCATAGTAAAATTTAAACAAT
TCTTTTGCTAATTAATCTCACCATTCACTTTTGCAATAAGATTAAGTAATTGAGAACTCT
AATCGTATCAACAGTTAACAAGAGATGTAAAATATTTAAAAACTAGTTAAACAATCTAAA
ACAGTTGATGTAAGCGACTCTATTTTTAAATGA


>TTHERM_00389810(protein)
MGKCISHITRKDWYKNCNKGCLYCFGYNCDMCAVDLQDGWNRCCDVLCFFCTFSCCQCQC
TLIKNCYHGIMNKIEPCCSACGRLNDKLLKFCQNECDDMCECHCYCENPCIVRDVNNKQF
LEYMSEFKIKVNFYNDSIFGEACILQKQSTGELFTVKVIQYNNENKFLQGDQQFKRRLQI
FHPNIVNLKHVESFTEDSFCSLRIKNFLFFDFVLMDLQTEINYRKKTNCFFKEEELWNLI
EGTLQALYYFYEIKLEHQGIRADRIYVSQLGQFKIADPYLLQSSNNFDDVKEAYFQSDTI
SENIFLSPDQFYKITQDDEYKASNKYENRFKSDIFSLGMIFLCAASLENLASLYNFEDSC
IDLHSLNFKIENTASRYKSQILGRLLLGMLEENQDKRLDAKKALLLIQTEDKVKQCIIES
RTNQQQQGLKDLQTPIKQRSLSVINEILENDNFHFQNIGNNSFEDKISNPLEMSRGGGGT
TSNKQITIQSMQTPVMRNQTIKQFSPYKQESEQVLKSFYNLEYKKIVDGQILNFQFTGLG
EDSEQIQLSDLGTIAVNNTQKTLLERLWVQCKESKFIQKVNCFKKKKQISELSLSQVKFG
ILFNENRDIIYEGNLYEENIKHGEGKLFEGSQIYIGNFSFDKKDGIGKITDLQGHVLFEG
SFVNDKKEGQGIEYNMTYDENQLIHFKNFHKNWKKFEGQYSNSKKNGEGIYTYHNNHKFK
CNFINNFADGEGVYLNEQDQVLFKAIYKKNKIQRVIQNFSLYPQPLSTGGGLSPQQNLNN
SFANQSHHSLLQQDQVIENSNRINSQQEMQNIQKLVKQSKTVDVSDSIFK


>TTHERM_00389810(gene)
ATGGGAAAATGTATTAGCCACATAACTAGAAAAGATTGGTATAAGAACTGCAACAAGGGT
TGCTTATATTGTTTTGGATATAACTGTGATATGTGTGCAGTTGATTTACAAGATGGATGG
AATAGATGTTGTGATGTTTTGTGCTTTTTTTGTACTTTTAGTTGCTGCTAATGTTAATGT
ACTCTAATCAAAAATTGCTACCATGGAATAATGAATAAAATTGAGCCTTGCTGTAGGTAA
ATTACTCATTAACTCTTTTAAAATTACATAAATTCTTACATACTAATAAGTGCATGTGGT
AGACTAAATGATAAATTACTTAAATTTTGCTAAAATGAATGTGATGATATGTGTGAATGT
CATTGCTATTGTGAGAATCCTTGTATAGTTAGGGATGTGAATAACAAATAATTTCTAGAA
TACATGTCTGAGTTTAAAATAAAAGTTAATTTTTACAATGATTCAATATTTGGTAATAAA
ATTTTGTTTGAACTTTCAAGTTTCCATAATTTTGATTTAATTATCTTAATTTTAAAGGAG
AAGCGTGTATCCTTTAGAAATAATCTACAGGAGAATTGTTTACTGTGAAAGTAATTTAAT
ACAATAATGAAAACAAATTTTTGTAAGGAGATTAATAATTTAAAAGAAGACTGCAAATAT
TTCATCCAAATATTGTTAATTTAAAACGTAAGTACTTAATTCTTAATAATATATAAAAAT
AAAGCAAGTTTTCGTTTTTGTAATTTAGATGTTGAAAGCTTCACTGAAGATTCATTTTGT
AGTTTAAGAATTAAAAATTTTCTATTTTTTGATTTTGTATTAATGGATTTATAAACTGAG
ATCAATTATCGAAAAAAGACAAATTGTTTTTTCAAAGAAGAGGAGCTTTGGAATTTAATT
GAAGGAACTTTACAAGCTTTGTACTACTTTTATGAAATTAAATTGGAGCATCAAGGTATA
AGAGCTGATAGAATATATGTTAGTTAATTAGGCTAATTTAAAATAGCAGATCCTTATTTA
CTCTAAAGCTCTAATAATTTCGATGATGTTAAAGAAGCATACTTTTAATCTGATACCATA
TCTGAAAATATTTTCTTATCGCCTGACTAATTTTATGTAAGAAAAGCTTATTTTATATCA
AATAAGTAGATTTGTTTAATTTTTTTTAAAGAAAATAACTTAAGATGATGAATATAAAGC
TTCTAATAAATACGAAAATAGATTTAAATCTGATATATTTTCTCTAGGAATGATTTTTCT
ATGTGCAGCATCTCTTGAAAATTTAGCTTCGTTGTATAACTTTGAAGATAGTTGTATCGA
TTTGCACAGTCTCAACTTTAAAATAGAAAATACAGCATCAAGGTATAAGTCCTAAATTTT
AGGAAGACTATTGTTAGGGATGCTTGAAGAAAATTAAGACAAGAGATTAGATGCTAAAAA
AGCGCTTTTACTTATTCAAACTGAAGACAAAGTTAAGTAATGTATAATAGAATCTAGGAC
AAATCAGTAATAATAAGGCCTAAAAGATCTATAAACACCAATAAGTAATTATTAAATCTA
TTAAGCTGACAAAGAAATAGAATAGTAAATTTGTTTATTTTATAATTAGAATAAAGGAGC
TTGAGTGTTATAAACGAGATACTGGAGAATGATAACTTCCATTTTTAAAATATTGGAAAC
AATTCTTTTGAAGATAAGATTTCGAATCCTCTGGAAATGTCGAGAGGAGGAGGTGGTACA
ACTTCAAATAAATAAATAACTATTCAGAGTATGTAGACACCAGTAATGAGAAATTAGACA
ATCAAGCAATTTAGCCCTTATAAATAAGAATCTGAATAGGTACTTAAAAGTTTTTATAAT
TTAGAGTACAAAAAAATAGTTGATGGTCAAATCCTTAATTTTTAATTTACTGGCCTAGGT
GAAGATTCAGAATAAATTTAGCTGTCTGATTTGGGAACTATAGCTGTAAATAATACTTAA
AAAACTCTTTTAGAGAGATTGTGGGTTTAGTGTAAAGAAAGCAAATTCATTCAAAAAGTG
AATTGTTTTAAGAAAAAAAAATAAATTTCAGAACTGTCTCTATCATAAGTAAAATTTGGA
ATCTTATTCAATGAGAATAGAGATATAATTTACGAGGGAAACCTCTATGAAGAAAATATC
AAGCATGGGGAAGGAAAGTTGTTTGAAGGAAGCTAGATATATATAGGAAATTTTAGTTTT
GATAAAAAAGATGGCATTGGTAAAATTACTGACTTGCAAGGACATGTTTTATTTGAAGGG
AGTTTTGTGAATGATAAAAAAGAAGGTTAAGGAATAGAATATAATATGACTTATGATGAA
AATTAGCTTATACATTTTAAAAATTTCCATAAAAACTGGAAAAAATTTGAGGGCTAGTAC
TCAAACAGTAAAAAAAATGGTGAAGGAATTTACACTTATCATAACAATCATAAATTTAAG
TGTAATTTTATAAACAATTTTGCTGATGGAGAAGGGGTTTATTTAAATGAATAAGATTAA
GTACTTTTTAAAGCTATTTATAAAAAAAACAAAATTTAAAGAGTTATTTAAAACTTTTCT
TTATATCCTCAACCATTATCTACAGGTGGAGGACTTTCTCCATAGTAAAATTTAAACAAT
TCTTTTGCTAATTAATCTCACCATTCACTTTTGCAATAAGATTAAGTAATTGAGAACTCT
AATCGTATCAACAGTTAACAAGAGATGTAAAATATTTAAAAACTAGTTAAACAATCTAAA
ACAGTTGATGTAAGCGACTCTATTTTTAAATGA