Identifiers and Description

Gene Model Identifier

TTHERM_00692980

Standard Name

MRNO05 (Membrane Occupation and Recognition Nexus protein other)

Aliases

PreTt02882 | 107.m00062 | 3753.m00357

Description

Protein with predicted MORN domains localized throughout the protein and/or associated with other domains having a predicted function. Protein kinase domain containing protein.

Genome Browser (Macronucleus)

GBrowse

Genome Browser (Micronucleus)

GBrowse

Gene Ontology Annotations

No Data fetched for Gene Ontology Annotations

Domains

No Data fetched for Domains

Gene Expression Profile

  • Tetrahymena Functional Genomics Database:

TetraMine Data

TTHERM_00692980

WebApollo

Fullscreen View

Tetrahymena Stock Center

No Data fetched for StockID

Homologs (v.2006 protein sequences)

SourceIdentifierScoreDescription
Tetrahymena borealisEI9_18392.19.997093137033517e-262protein kinase domain-containi
ng protein (709 aa)
OxytrichaContig16869.0.g269.99946582325553e-18MORN repeat
SGDYOR231W0.00000019998969434520019MKK1 Mitogen-activated kinase
kinase involved in protein kin
ase C signaling pathway that c
ontrols cell integrity; upon a
ctivation by Bck1p phosphoryla
tes downstream target, Slt2p;
functionally redundant with Mk
k2p
WormBaseWBGene000104270.0000004998288985444982locus:hpo-11 status:Partiall
y_confirmed UniProt:G5ED17
protein_id:CAA15621.3
DictyBaseDDB_G02708140.0000007997233352734267nek2 on chromosome: 1 position
4847143 to 4848761

General Information

No Data fetched for General Information

Associated Literature

No Data fetched for Associated Literature

Sequences

>TTHERM_00692980(coding)
ATGATGGATAAAATTGATGAAACTGATAAACTAGATAAAAAGAAGAAAAAGAAGCATATT
ATTGAGTATAATTAGTTTATTGAAGAATTTGAATTCGTCCATCTTTCTGGATTGAAAGGT
CTTGAAAGAGCTCGTCAAATTCAATAGAAGAGCACAAATAAAATGTTTGATTACATTGAG
ATGGATTTGAGAGGAGTAGATACAATAGATAAATATGAAAATTACTGTGAGAGTTTATTC
GAGATAAATTAAAAGGAAATCTTGCAAATGAAGTTTTATTCAAGGGTATTTGTAGAAGAA
TCGCTTGGAGATCCTTATTGCAGATACTTTTTAATATTTGAATATTGCGAAAGTTCAGTG
GAAACAGAAATATAGCATTTAAAAAAGAGGAATAAGCAACTTAAAAAATCTACACTTAGA
AAAATATTTGAATCTGTTGCTATTGCATTGAATCACTTTCATACAAAGCAGATAGTTCAT
GGAGATTTGAGATCATCTAAAATATTTAAAAATGAATAAGGCTAATATAAATTGATGCCT
CCTAAAATCAAAAATAGGAAGGCTACTGAAAAATATTACCACTCACCCGAATATCACCTT
AGCAAAAATTTTAGAGCAGCATATGAGAAATAATAAAATAATCCCATTAAGGGAGAAATT
TATACATTTGGTATGATAATGTTAGAACTAGGTACTTTCAGTGATGACTTATATAATGCA
TATGGAAAGTTTTAAATGAATGAAGATGTGATTTAAAATGCTTTATAGAATTTTTCTATG
CTTTATGGTTATCATTTAACAGCGGTTGTAAAGAAGATGCTCAATTTAGATGCATAACTT
AGGCCTACTGCTAATGACATTATAGAGCTTCTCCAATCTTAGGAATTACATGAAATGGAA
AAGGAAATTAATAACCCTTATATTAAACTACAACATAGCTTTTAAAGTGAAAGTGAAGAA
GATAGCAATGCTGCTACAACTATTCATGCGAATTAAAATGGTTTGCACCCCTAATCTCAT
GAAGAAAAATTTAAGAGGGAAGATGGAAATAAAAAATCTACATTCTTTTAACTACAGCCT
TAGAGCTCTTAAAATATTTAGTTACCAGCAATTAAAATAAACATTAAAGCACCTTCTAAT
GTAGAATCACAAGATTCTTAGCAAGATATTTTAAACACAAGCACAGTTATTGGTAAAAAT
AATGTTCTTTAAACTCATCAAAGTTCAGATAAAACTCCGGTTACTAATAGAAGCTAAAGG
AGTAGACAAGGGACACAAATATATGTCAAAAGTAGTTTAAGTAGACAACAATCTAATTCA
TCAATTTAAGGAGATACCAAGAATTTTTAAACATTCGGAAGAGTTGCTAAGGCAGTCATA
AAATTAAAAGACTCAGTTAGGAATGAAGAAGAGGAAGAAGACAATGACGATTTGCTTAGA
GAAAAAAAAATATATGAAACATTACCATAAGAATATTAAGATGAAATAGATTCAAAAGTC
AATGAAAATCTTAAAAATATCGAAAGAGATTATACAGTTGATTATTTACCAAACGGTCAT
AGATATTAAGGTGAAAAATTGTAAGGGGTTCCTCATGGATGGGGGATTTTTTGGTGGGCA
AATGGAGAAATTTATGAAGGAGAATTTTTAAACGGGAAGTATCATGGAATAGGTATTTAT
TACTGGCCTACTGGCGTTAAGCATTATGGTGAATTTAGTTATGGAGAAATTAAAGGATTA
GGAGTTAGGTTTTATTAAGAGGGAGATATTTATTTTGGTGAGTGGCATAGAGGAAAAAAC
CATGGAAAAGGAACTTTTTATTGGTAAAAATCTTTAGCAAAGTTTAAAGGAAATTTTCTA
AAAGATAAAATATATGGGAAAGGAACTCTAATATTACCAATATTCGAAGATAGAGACTAA
GAACTAGGAGAGTATAAGGGTTCATAAAAATCAAGTATATTCTAAGACAAAGATTAAAAT
AAAGACAAAGTAAAAGAAACAAGAATTTACGAAGGTTTATGGAAGGATGAAGAAGGAAAA
GGTATTTATGTAGAAGAAATTGAATTCTCTGCATAAAAAGAAGGAGAGGATATACCTATT
CAAGTAATAGAAGAGCCTGAATAAATTGTAACTAAATAGCGCTGGAAGATATGA


>TTHERM_00692980(protein)
MMDKIDETDKLDKKKKKKHIIEYNQFIEEFEFVHLSGLKGLERARQIQQKSTNKMFDYIE
MDLRGVDTIDKYENYCESLFEINQKEILQMKFYSRVFVEESLGDPYCRYFLIFEYCESSV
ETEIQHLKKRNKQLKKSTLRKIFESVAIALNHFHTKQIVHGDLRSSKIFKNEQGQYKLMP
PKIKNRKATEKYYHSPEYHLSKNFRAAYEKQQNNPIKGEIYTFGMIMLELGTFSDDLYNA
YGKFQMNEDVIQNALQNFSMLYGYHLTAVVKKMLNLDAQLRPTANDIIELLQSQELHEME
KEINNPYIKLQHSFQSESEEDSNAATTIHANQNGLHPQSHEEKFKREDGNKKSTFFQLQP
QSSQNIQLPAIKINIKAPSNVESQDSQQDILNTSTVIGKNNVLQTHQSSDKTPVTNRSQR
SRQGTQIYVKSSLSRQQSNSSIQGDTKNFQTFGRVAKAVIKLKDSVRNEEEEEDNDDLLR
EKKIYETLPQEYQDEIDSKVNENLKNIERDYTVDYLPNGHRYQGEKLQGVPHGWGIFWWA
NGEIYEGEFLNGKYHGIGIYYWPTGVKHYGEFSYGEIKGLGVRFYQEGDIYFGEWHRGKN
HGKGTFYWQKSLAKFKGNFLKDKIYGKGTLILPIFEDRDQELGEYKGSQKSSIFQDKDQN
KDKVKETRIYEGLWKDEEGKGIYVEEIEFSAQKEGEDIPIQVIEEPEQIVTKQRWKI


>TTHERM_00692980(gene)
ATGATGGATAAAATTGATGAAACTGATAAACTAGATAAAAAGAAGAAAAAGAAGCATATT
ATTGAGTATAATTAGTTTATTGAAGAATTTGAATTCGTCCATCTTTCTGGATTGAAAGGT
CTTGAAAGAGCTCGTCAAATTCAATAGAAGAGCACAAATAAAATGTTTGATTACATTGAG
ATGGATTTGAGAGGAGTAGATACAATAGATAAATATGAAAATTACTGTGAGAGTTTATTC
GAGATAAATTAAAAGGAAATCTTGCAAATGAAGTTTTATTCAAGGGTATTTGTAGAAGAA
TCGCTTGGAGATCCTTATTGCAGATACTTTTTAATATTTGAATATTGCGAAAGTTCAGTG
GAAACAGAAATATAGCATTTAAAAAAGAGGAATAAGCAACTTAAAAAATCTACACTTAGA
AAAATATTTGAATCTGTTGCTATTGCATTGAATCACTTTCATACAAAGCAGATAGTTCAT
GGAGATTTGAGATCATCTAAAATATTTAAAAATGAATAAGGCTAATATAAATTGATGCCT
CCTAAAATCAAAAATAGGAAGGCTACTGAAAAATATTACCACTCACCCGAATATCACCTT
AGCAAAAATTTTAGAGCAGCATATGAGAAATAATAAAATAATCCGTAAAGATAATTTTAA
GAGAATAAACAATTTTTAATAAAGAAATATATTTTTAATAACAGCATTAAGGGAGAAATT
TATACATTTGGTATGATAATGTTAGAACTAGGTACTTTCAGTGATGACTTATATAATGCA
TATGGAAAGTTTTAAATGAATGAAGATGTGATTTAAAATGCTTTATAGAATTTTTCTATG
CTTTATGGTTATCATTTAACAGCGGTTGTAAAGAAGATGCTCAATTTAGATGCATAACTT
AGGCCTACTGCTAATGACATTATAGAGCTTCTCCAATCTTAGGAATTACATGAAATGGAA
AAGGAAATTAATAACCCTTATATTAAACTAGTATTTAAATAATTTGCCGTTTGTTTTAAT
TTATTAAATTTTATTCTTAAAAATAGCAACATAGCTTTTAAAGTGAAAGTGAAGAAGATA
GCAATGCTGCTACAACTATTCATGCGAATTAAAATGGTTTGCACCCCTAATCTCATGAAG
AAAAATTTAAGAGGGAAGATGGAAATAAAAAATCTACATTCTTTTAACTACAGCCTTAGA
GCTCTTAAAATATTTAGTTACCAGCAATTAAAATAAACATTAAAGCACCTTCTAATGTAG
AATCACAAGATTCTTAGCAAGATATTTTAAACACAAGCACAGTTATTGGTAAAAATAATG
TTCTTTAAACTCATCAAAGTTCAGATAAAACTCCGGTTACTAATAGAAGCTAAAGGAGTA
GACAAGGGACACAAATATATGTCAAAAGTAGTTTAAGTAGACAACAATCTAATTCAGTAA
ATAATCGAATTATTTCAGAATTTAATCTTGAAAAAAATGGTTTTAGTTTGTTTAATTGAA
ATCTTAAGATTTTTAATTTTTAAGTCAATTTAAGGAGATACCAAGAATTTTTAAACATTC
GGAAGAGTTGCTAAGGCAGTCATAAAATTAAAAGACTCAGTTAGGAATGAAGAAGAGGAA
GAAGACAATGACGATTTGCTTAGAGAAAAAAAAATATATGAAACATTACCATAAGAATAT
TAAGATGAAATAGATTCAAAAGTCAATGAAAATCTTAAAAATATCGAAAGAGATTATACA
GTTGATTATTTACCAAACGGTCATAGATATTAAGGTGAAAAATTGTAAGGGGTTCCTCAT
GGATGGGGGATTTTTTGGTGGGCAAATGGAGAAATTTATGAAGGAGAATTTTTAAACGGG
AAGTATCATGGAATAGGTTAATTAATTTATGATAGATTGTAAATCAAAAAAAATAATTAA
TTAATTTATACAAATTTTAGGTATTTATTACTGGCCTACTGGCGTTAAGCATTATGGTGA
ATTTAGTTATGGAGAAATTAAAGGATTAGGAGTTAGGTTTTATTAAGAGGGAGATATTTA
TTTTGGTGAGTGGCATAGAGGAAAAAACCATGGAAAAGGAACTTTTTATTGGTAAAAATC
TTTAGCAAAGTTTAAAGGAAATTTTCTAAAAGATAAAATATATGGGAAAGGAACTCTAAT
ATTACCAATATTCGAAGATAGAGACTAAGAACTAGGAGAGTATAAGGGTTCATAAAAATC
AAGTATATTCTAAGACAAAGATTAAAATAAAGACAAAGTAAAAGAAACAAGAATTTACGA
AGGTTTATGGAAGGATGAAGAAGGAAAAGGTATTTATGTAGAAGAAATTGAATTCTCTGC
ATAAAAAGAAGGAGAGGATATACCTATTCAAGTAATAGAAGAGCCTGAATAAATTGTAAC
TAAATAGCGCTGGAAGATATGA