Identifiers and Description

Gene Model Identifier

TTHERM_00698640

Standard Name

MRNO04 (Membrane Occupation and Recognition Nexus protein other)

Aliases

PreTt14859 | 109.m00077

Description

Protein with predicted MORN domains localized throughout the protein and/or associated with other domains having a predicted function

Genome Browser (Macronucleus)

GBrowse

Genome Browser (Micronucleus)

GBrowse

Gene Ontology Annotations

No Data fetched for Gene Ontology Annotations

Domains

Gene Expression Profile

  • Tetrahymena Functional Genomics Database:

TetraMine Data

TTHERM_00698640

WebApollo

Fullscreen View

Tetrahymena Stock Center

No Data fetched for StockID

Homologs (v.2006 protein sequences)

SourceIdentifierScoreDescription
Tetrahymena borealisEI9_01256.11.000296925633081e-74hypothetical protein (495 aa)
OxytrichaContig14161.0.g640.000009999254677478949MORN repeat

General Information

No Data fetched for General Information

Associated Literature

No Data fetched for Associated Literature

Sequences

>TTHERM_00698640(coding)
ATGAATTAATTAGCATGTAATACATAAAATGTGAATGGGTAATAATACATGGGCAACAAC
AATTAATTTGTATTTGAGAATTAAATAAAATAAGCACTCAGCAATTTTGATTAGCAATTT
GAGTAAAATTAAAAAAGACTTAATGAGTTTATACAAGAATAAAAGGAGATCATGAGATAA
TAATTTGAATAATTTTTGAGAGATGAACCCTAAAATGTGCTGTAATTTATCAGAGGTTAG
ATTGAACCCATATAGAAGCTATTTGATTGTATTAATGATAGCATAAAACAATAATACAGC
TAAAATGAAACTTAGGTTAATATCGATTTTACTTCTTATTTGGATAAATTTGGCATTCCA
GATTTCATGAGAGAGCAACTAAAAAAGTTCAATTTTAATTTAGATGAATTTGAAAATGCG
GAGTCTTAGGATTTGATAGAAGAGGACAGAGAGAAATCACTAATTATTGGACAGAAAGAT
AATAAAAACTAATACAGTGGTAGAGCTCTTATCATTTACAAAAGTGATCCAGCAGCGATT
TATTTAGGATATATGAAAGATAACAAACGTCATGGAAGAGGTATTCTTGTCTTGAATGGA
TTTTAGTACTACTTAGGAGAATTCTACAATAACAAAGAATGGGGTTATGGAGAAATACAA
TTAATTAACAAAGAAAACAAGAATGAGAAGTATGTTGGTTACTTCTCTGAAGGCAAGAGA
TGTGGTTCAGGTTAGTAAGTGAATTTGGACACTAATACTAAAGAAGAATCAACTTATGTA
TCAGTTAATTATTTTAATGAGAGTCTCCATGGACCTAGAGTTCAAAGTTTTGGATAAAGT
TAATAATACAAATTCTAGCTCTTCTAGTATGAAAAGAATTACTTCTCCTTTAAAGATCAA
TGGAGTGATAAGGCTCCTTTATAAAATATTTTTGTATCTACCAAAGGCAAAACAGAAGGC
TAGGCTCTGAATTTGTCTCCTGAGCTTTCTATTGACCACTCATTCAAAGAAGATCAATAG
ATTAATTAAGAACAACCAAATCCTTATGAGATTCCTTCTATTAACTAGAACAACTTTCCC
TAAAATTAATAATTTGGATAACAAAATTTCTAAAATAACCCATATTTTATGGCTCCACCT
TAAAATTACATGCAAAATCCATAAAATTTCATGCCACCATAACAAGGTATTCCTTTTCCA
CCACAATACCCATATTAAAACCCATAACAATAGTTTCCACTTAATCCAAATGCTTAATTT
TAATAATAATAAGTTTATAAGAGCGTAATTAAACAAGTTATTTTTGATAACATTAATAAA
TAATGA


>TTHERM_00698640(protein)
MNQLACNTQNVNGQQYMGNNNQFVFENQIKQALSNFDQQFEQNQKRLNEFIQEQKEIMRQ
QFEQFLRDEPQNVLQFIRGQIEPIQKLFDCINDSIKQQYSQNETQVNIDFTSYLDKFGIP
DFMREQLKKFNFNLDEFENAESQDLIEEDREKSLIIGQKDNKNQYSGRALIIYKSDPAAI
YLGYMKDNKRHGRGILVLNGFQYYLGEFYNNKEWGYGEIQLINKENKNEKYVGYFSEGKR
CGSGQQVNLDTNTKEESTYVSVNYFNESLHGPRVQSFGQSQQYKFQLFQYEKNYFSFKDQ
WSDKAPLQNIFVSTKGKTEGQALNLSPELSIDHSFKEDQQINQEQPNPYEIPSINQNNFP
QNQQFGQQNFQNNPYFMAPPQNYMQNPQNFMPPQQGIPFPPQYPYQNPQQQFPLNPNAQF
QQQQVYKSVIKQVIFDNINKQ


>TTHERM_00698640(gene)
AAAATAAAATTTAAAAGCAATTGCGAAAAGGAAAAACAATCTAATAAACATACAAATAAT
ATATCGAATATAAATAATTCTTTGATAAAGACAAAATACTTTAATAATAAGATAAATAAA
AATTTTTAAAGACAATCTTTTAGTTTGTTAATAGATAAAATAGATTCGAAATAGAGAAAA
TAAATAACAGAATTAGACTAACCTCTTTTTGCACTCAAAATGAATTAATTAGCATGTACA
TTAAACTAACATTTATCATTTTTAATAGGAAAATGCACAAATTATAGTTGTGGACATGAA
ATTTGCAATGCTTGCATAGATAATCATAAACTTCACAGAAATTGCATTATGATGTATTAA
TAAAATTTTTAAAATTAAGGTAATACATAAAATGTGAATGGGTAATAATACATGGGCAAC
AACAATTAATTTGTATTTGAGAATTAAATAAAATAAGCACTCAGCAATTTTGATTAGCAA
TTTGAGTAAAATTAAAAAAGACTTAATGAGTTTATACAAGAATAAAAGGAGATCATGAGA
TAATAATTTGAATAATTTTTGAGAGATGAACCCTAAAATGTGCTGTAATTTATCAGAGGT
TAGATTGAACCCATATAGAAGCTATTTGATTGTATTAATGATAGCATAAAACAATAATAC
AGCTAAAATGAAACTTAGGTTAATATCGATTTTACTTCTTATTTGGATAAATTTGGCATT
CCAGATTTCATGAGAGAGCAACTAAAAAAGTTCAATTTTAATTTAGATGAATTTGAAAAT
GCGGAGTCTTAGGATTTGATAGAAGAGGACAGAGAGAAATCACTAATTATTGGACAGAAA
GATAATAAAAACTAATACAGTGGTAGAGCTCTTATCATTTACAAAAGTGATCCAGCAGCG
ATTTATTTAGGATATATGAAAGATAACAAACGTCATGGAAGAGGTATTCTTGTCTTGAAT
GGATTTTAGTACTACTTAGGAGAATTCTACAATAACAAAGAATGGGGTTATGGAGAAATA
CAATTAATTAACAAAGAAAACAAGAATGAGAAGTATGTTGGTTACTTCTCTGAAGGCAAG
AGATGTGGTTCAGGTTAGTAAGTGAATTTGGACACTAATACTAAAGAAGAATCAACTTAT
GTATCAGTTAATTATTTTAATGAGAGTCTCCATGGACCTAGAGTTCAAAGTTTTGGATAA
AGTTAATAATACAAATTCTAGCTCTTCTAGTATGAAAAGAATTACTTCTCCTTTAAAGAT
CAATGGAGTGATAAGGCTCCTTTATAAAATATTTTTGTATCTACCAAAGGCAAAACAGAA
GGCTAGGCTCTGAATTTGTCTCCTGAGCTTTCTATTGACCACTCATTCAAAGAAGATCAA
TAGATTAATTAAGAACAACCAAATCCTTATGAGATTCCTTCTATTAACTAGAACAACTTT
CCCTAAAATTAATAATTTGGATAACAAAATTTCTAAAATAACCCATATTTTATGGCTCCA
CCTTAAAATTACATGCAAAATCCATAAAATTTCATGCCACCATAACAAGGTATTCCTTTT
CCACCACAATACCCATATTAAAACCCATAACAATAGTTTCCACTTAATCCAAATGCTTAA
TTTTAATAATAATAAGTTTATAAGAGCGTAATTAAACAAGTTATTTTTGATAACATTAAT
AAATAATGA