Identifiers and Description

Gene Model Identifier

TTHERM_00396960

Standard Name

MRNO03 (Membrane Occupation and Recognition Nexus protein other)

Aliases

PreTt23621 | 42.m00355 | 3813.m01571

Description

Protein with predicted MORN domains localized throughout the protein and/or associated with other domains having a predicted function. Leucine Rich Repeat family protein.

Genome Browser (Macronucleus)

GBrowse

Genome Browser (Micronucleus)

GBrowse

Gene Ontology Annotations

No Data fetched for Gene Ontology Annotations

Domains

No Data fetched for Domains

Gene Expression Profile

  • Tetrahymena Functional Genomics Database:

TetraMine Data

TTHERM_00396960

WebApollo

Fullscreen View

Tetrahymena Stock Center

No Data fetched for StockID

Homologs (v.2006 protein sequences)

SourceIdentifierScoreDescription
Tetrahymena borealisEI9_11563.19.997093137033517e-262hypothetical protein (340 aa)
DictyBaseDDB_G02679620.00000000009998509410508463tsuA on chromosome: 1 position
1191800 to 1198906
WormBaseWBGene000214610.00000000039982266684865623locus:nekl-1 status:Partiall
y_confirmed UniProt:Q6AW07
protein_id:CCD69902.1
OxytrichaContig22200.0.g710.000000009996807949091551Protein kinase domain
SGDYCR073C0.000000019990673443141236SSK22 MAP kinase kinase kinase
of the HOG1 mitogen-activated
signaling pathway; functional
ly redundant with, and homolog
ous to, Ssk2p; interacts with
and is activated by Ssk1p; pho
sphorylates Pbs2p

General Information

No Data fetched for General Information

Associated Literature

No Data fetched for Associated Literature

Sequences

>TTHERM_00396960(coding)
ATGAACAATATCCCAGCAGACAGATGTGAGTAAAAATCGCTTGATGAACAAGGGAAAAGT
GATATTGATGAAGAAAACAACTAAAAAAATCTTTATAATTAAATCAGTGGCCTTGAAGCA
TAATTTTTATAATACGATCGCAATGATAATTTTAATGAAAGATATGAAGAAGAAGAAAAA
ACGATTACAAATAATAATGAGTTCTCAAATACATATTAATTAGAAACAAAGAAAGATGAA
ACAATAGATTCTAATTCAATCATTGATGGTTCATCAAATACCTCCTCCTCTTAAATTTGG
AATGGAAGTAGAGTTTAAGATGGATTAGAATAAATTTACACAAATAAAAAAATGATGAAA
AGAGACTCTCTAAAGTAGCAAGTATTAAATAATTAGCACTAATTTAGTAGAAGATAAAGC
TTTAATCCACATTAATCAATGCTTAATTATTCATAATTTTGCCCAAAAAGAAGCAGCCTT
TTAGGAAACTCTTTTCCTTTACAAATCACAAGCTAAGAGTAATTTTCAAGTCAATTTTCT
AACCAAAAAACTATGCAAACTTAAAGCAGAACAAATCTATAAATTAATGGGGTCAAAAAT
CATAAATTTGAAGAATAAAATCAAGCTATTTCTAGCATTAGCACAAGCATTTAGAATTTT
TAAAATTTAGAGAGCAGCGTTTCTCTAAGTCGCTCTAAAAAAGTTATTAAAATTTCTAAA
GATAAAATAGAAGCAAGAGTTAAGCAGTAACTTTTACAAGCTTAAACTCTTGGCAGTATT
TCTAGCACAAATTCATTTGACGATTCTCCTATTACAAGAATAAATAAGGGAAGTACAAAG
TTGCACTTAATACAAAATCATCAACAATAAAAGGGAACATTTAAAAGCCAATAGCTGCTA
TTTCTCCCACTTTCAAATATAAATGATCCAAAAAGAATTTCGATATGTCTTCATGAGGAT
ATGGCTGAAGAATACAATAAATTTATGATGATGAATAATCCAAATTAGCCTTCTTAAATT
TCTTAAATTAAATCTAAAAATCAAAACACTCTCTCTGAAGCTAGTATTTGTGGTAACACT
GTTTTTGAAGAAAATGAAGATGTTCTATCAGGAGTTATAAATAGCTCAGATTAAGAATAA
ACACAATACACAATCACTGAAAATAACATAACAGAATAAAGTGATTCTTCAAATTCTTCT
TCTTAAATTAATACACCTTCTCCTATTGAAATAAAGACTACTAAGCAAAGGGTACATTAG
TTTTACACAGAACAGTGCTTGGATAAAGCTTAAAGGAAAAAATAAATAACAAATTAACAT
GGTTCATCTTTTAAAAATAAATACATGAGCAAAACAATACCTAGCATTGATGACTACGAA
GAAAATGAAGAGGAAATTAAGTTCAACGAAACAGTTTTGCTTAAAACTGAAAAGTAAATA
ATAAATCCAAGTGATAAAAGTGATAAGAAAGAAAAGAAGTCAAATGAAACTAAAAGAATT
TCAAAAGATGAATATTCATCAAATTAAACAAACAAGAAATAGTTTATTTAGGATCAGACT
GAGTATATGTATAGAAGCAATAATAAAATAGAAAAGCCTGAACCAAATAAAAATCATAGC
AATTAAGCAGCTGCAAAATAAATAGATTCTAGGATTAATACAAAAAACCACAACAGTAAT
GTGAAAGTTGTAGAAAATCACAATGGATATGGTTTTAATCCAAATTAAAAAGTAAATATA
GAAGATTATAATATAGGATTGGTTTATGGCGGAGACTTGAAGAGACAGGAAAACAAAGAA
AAAATATGTAATATTCTATTGAGTAAGTAATATAGCGATCTTCTAGAAATAGGAAGTGGG
TCGTATGGACTTGTTTTGAGAGCTACAACACCAGAAGGATATATCAGAGCTCTTAAAATA
CATTATGGAATTACTTAAGATGAATCTGCTTTCCTAGATAGACTTAATACTTTAACTGCA
AATAGCATAATGGCTTATAATACATTTAAATTTAGAGACACGGTTAGCAAGAAATAGATA
GAAGTTATAGAAATGGAGCTTGCAGATGGTTCTCTAAAGAATCAAGTGTATGCAGATGAA
TCAGAAATCAGTGATGAAAAGTATCGGTAAATATGTATTTAACTTATTGTAAATGTGCTC
TCAATGCATAATATGTGCGTAGTGCATAGGGATTTGAAGCTAGATAATATTTTAGTTAGT
AACGGGAATTACTTTTTAGCGGATTTTGGTATATCTGAAGAAATAGGCAGTCATTAGTTA
ACTTAAAATTTTATTCCTGGAACTGATTGCTTTTCAATAAAGCAAAATATAGCAGGAACA
TAGCTTTACTTTTCTCCTATAATAAGGGATGCCCATTCAGCTTAGCCGAAAAAATACATT
ATCGAGCACGATCCCTTCAAATCAGACCTATATACAGTAGGTCTAATTTTACTAGAAATT
GAGCTAGTAAGATAAAAGTATTAAAGACATTAGATACAACAGATTCTCAGAGACAAGCAT
TAGGCTTATAAATATGCTCTCAAAATGAATATAAACAAGTATTTAATAAAAGATAATTAC
TACATCCTAAAAAACCGTCTCTATAAGCCAATAAACATATTAGCAGAGCTTCTTTAAATT
GAAGAAATTAATCGAATCTCTTCTATAAAGCTTTGTCTTATTTGTCAGTTAGATAAAATT
ATCTTAAGCAACATCATAGTCCCTCATCATAAGATTTTTCCTCCTATTATTGAATTAAAG
TAAGATAATACTTGCATTATTAACTATACTATAAAGCTACTTATTTATGAAGGGTCATAT
ATTAAGATGGAAGATGGGAGAATTCTACGACACGGAGAAGGGTCTTTGTATAAACTAATT
GAGGGAGAAAGAGAGGTTATCAAAGCTTTAGTTTATGAGGGATAATGGGATAATGATCTT
CCTCATGGTTATGGTGTATTTTATTTTTTTTAGAATGATTGGGTGTATGAAGGTTAGTTT
AGAAATGGATAATTTTTTGGAGAAGGAAGCATAAAATTTATAGACTGGGTTGTTTATAAA
GGAACATGGTATAATTTTCTTCTTGAAGATTTTCTAATACCTGTAATTCCGACTGATTCT
GATTTATTCTTGCAAAAAGATTAGAAAAACGTAGAAGTTTTGATAAATACTCATGATAGA
GAAGGATACATGAAAAGCACTGGGCTGAATGAGGTGGAACTGCAGTTTGAAATTAATACT
TTTAGGTTTTACTCAAGTAATTTTATTGAGTTTAAGCAGTATTTAAAGGATAAATAAAGA
GTAAAAATACTTCTAACATCTAAAAAGAGCAAGCATGACTTTTAATAAAGCTCCCGCTAA
TAGCTGGTGCTACTGGCTGTTAATAGGAGAAAAAAAAGAATATTTGAGGTTTACATCAAG
TACTTTAAGCATGAGCTTATACTAGATGCCGTGATTTTAGAATAACTTATTTAATTACTC
AATTAACCTAGCTAATTAGGAAAAAATTCTTCAGATTTTTGTAATGAAAGTAGCAACAAA
TTAAATATTCAAAAATAATAAATCTAAGAAACTTCTTTGATGGTATCAGAAAACAATCTT
AGTGAATCTGATAGACTCTCATCATTTTAATCATCATTATCGTCAAATTACAATAGCTCA
AACCAAGTTTGTTCTATTGATGATTCTGATAGCATAATTTATTTAAATTTTGATTTATTT
AGTAAGGAAAGCGCAGTCTATTTTTTTGATAAAATTTCTAATAAAAATGATCCTTCGCTT
TCCATTTTTAAACTAGAGTATATGAAAAATATTGGTGTTTCTGCTTAAATTGAAGAAGAA
AGTCTGATTAAATTTTTACTCTCTAAGCAAGTTCAAAATCTAAAAGAATTAGATCTTTCA
AGCTCGAAGGATATTTCCTCTTCCATATTTGTAGCTCTGGATCATAACATAGAGTCTTTG
AAGATGCTCAACTTAAAATACGAAGCTCTATCTCAGCAAACATTTTGCTCACTTTTTAAA
TATCCTTTCCTAAAATAAATTGTGATTTTAGACTTTTCTTACTCTGAGTTTGATGATAAG
TGCATGCTTGAACTAGTATCATGTCCTTACTTAAATAATATTTAAATCCTGATATTTTGC
TTTTGCAGGAACTTAACACACAAGGGCTTAGAAATTTTCTTATAAAAGTCATCACATGAA
AACTTTCCTCAACTCACTCAGTTAGATTTTGAAGGTATTTTGTCAAAGGGTTATCATAAC
ATGAAAAATGATAAAATATTAACAAAAATTTCTTCTTAAGGAAACATACAAAACATAAAT
TATGAAAATATTCATTAAACAGAATAAGAGATGCTTCTTGCTTTTGATAGAAAGCATCAT
TTATATTCAAATAACTCCAATTTGACTATATTGGATTAAAAGCTAGTCTAATAATCAGCT
GGTAGTGCTGTATCTATTGATTGTATCAATAGCTCTGTTAGGAGTTTAAATAAAGAATAA
TAAAATAATTTAATTAAATAAAATGCATATTTCCACTATTTTCCTTACACTACTGACAAT
ATCCTTAAATAACTCGAGTATATATAAAAGTATAACATTCTTAGAAAAAATCTAGTTGAG
CTAAACTAAAGTGATGCTCATTCTTCATTAACTTCATGCGGAAATCTCACTTCAGCCATT
TAAATTTCTAACTGTGATGAAACAAATAATTAGCAACCTCAACAGCATGAAACTATCAAA
TAATAAATTTCTGATTAAAATATTAAATCTCAATAGCTTATAAAAGCAACCATTTAATCT
AACCAAAATATCTCTTTCAATACTTAACATTAAGCCTTTCATTCATCTATTTCAAATTTG
TCGTTAACAAATTTAAATAACTGCTCATCGCCCCACTCAAATAAAAACATCAACATTAAT
TAAAAAGTTTAATCAAAATAGTCATAATCATCTTCCTTTTTTAATTGGGTCAATAAATTG
ACAGACAAAAACTTATAAGCCTTCGAAAAATTTTCAAAATAAACAAAACTTTTCGGCATA
CAAATTTTAAGTTTTCGAGCAACAAACATAGACGATACTGTTTTGAAAAATCTAGCAAAA
AACAGTAGTTTTATTTATTTAAAATTTTTAGATATTTCACAATGCTAATAAATATTAAGT
GAAGGATTCGAAAGCTTAATTTAATCAAACTATTTAAAAAATTTAATTAAAATTGACATT
AGCCAAACTAACATCATTAGTATAACCTCGAAAAAACCACAACAAGTATTTCTATAATCC
TTAAATCTTGTTGAATGCCCAAATTTATCTCCTCAAAGCGTATTTAACTATTTATCTAAC
ATTCAGAACTAGTAAAATATAAGGCAACTCTACATCGATAGTGATATTTTCTTTGTTGCA
TAAATTAAGCAGTGCCTGCTAGAGTGCTAAAAGCTTTAAAATATCCATATTTTTGTCTCT
TCAAATAAAGTTGATTTTTTTATACAAAATCCTTTAACTTTGCATTTATTGATTGAGAAG
AAAGGATATAAATTAAATTTCTATTCTAGTAAATTATATATTCAGTCGCTTTTTGAATTA
GTGAAAAGTTAAGTGATTCAATGTATCTAAATTAAGAAAGAGTAGCTAAATTAAATCTTC
ATAAATGGCACTAGTTATGTAGATTTAAGTAGATTTGACCATCAATCAACACCTGATTAT
GAACAAGATACAATCTAAATTAATAGAGCTTAAATGCTTGATATTCCTTCTAAAAATATT
TCTTTTGAATAATTAAATGATGAAAATATTATTGAAGATTTAAGAAAATTGTTTAACTCA
AGAAACTTTTTGCTTATTAAATAATTAGATATTTCTAGACTTAAAGTTAATAGCTATGCA
GGATAGCTTCTAGCTGGCTCAAGATATACAAGATCTTTAACTTATATTGATTTAAGCTAT
TCTACAATAATAGACGAGGATCTTGATAAGCTAAGCAAATCTAAGTATCTTCCCTAGCTA
TAAGTAATCAAGTTAAACTGCTGTAAAGATATTACAGAAAAAGGAATAAATTACTTATTA
AATACCCAAAACAGCTTAGAAAATTTGAAGACTATTGAAGTAAAACAGAGGCTACTCAAC
ATATATTTACTTTACTCGTAAAACTCAGAAAAAATCCAAATAATTGCTGATTAAATACTT
TTCAAATATGAGCTAAATCAACTTAGAAATCATAACAATCACCATAAAGTCTTTTAATTC
GCTAAGTACTGGACGAAGATTTTTAGAGATAATATGTAAAATATAAACTCAATAGAAATA
TTAGGATTCGATGAGAATATAATTGACTATTTCTTGACCCATATAACAAGCAGGAATAGA
GTTAAGAAAGTCATTATTGATTTCTCTAAAAAGAATCAAAAAATTCAATCTTAATCCTAA
ATCTAAAATATCAACTAATTTTAAAGAATTAACCATATTTTTAGTAAACTGCCAGATCTT
TAAGAACTTCGTTTAGATTTCTCTGGGTGGAGTGATATGACTGATTTATCAATTAAAGAA
TTTTGTGAAAGTATTGTAGGACTGTAGAACTTAAAAGTTATAGATATAAACCTTTCAGAA
TGGGCAAAAGAAAATGAATAAATCACCGATTTATCGTGCATGTTTTTGGGTGAAATTTTT
TAGAAAATCTAAAAGATAAACGTAGTAAGTTTAGATCTCTCTAATTGGGGAGATGGCAAT
TGCAAGATTACTGATAAATCAATAGTATATTTGTAAAAAGGTATTCTTTGCACAAAGGAC
TATTTAACTTATCTATCTTTGAATTTGAATTCGTGGGGTTCATAGATGACTAACACTTCA
CTTATCAATTTGCATGATCTAGTCAGAGAACTCAATCTCTTGAGTTTTTTAAAGTTAGGT
CTTTAGGAATGGGGTAAAGATAATTCCAGTATTAATGATGATGGAATAGAATCATTAGCG
ATTGCGATTGGTAACTCAAGATTTCTGAATTAATTAGAAATAAATTTAGCCTATGCAGCG
ACTTTAAATAGCGGAATTGGAGATGTGAGTGTCTAGAATCTTGCAAAAAGTTTGATGAAT
ATCAATAGTTTAAGTTCTTTGAAAATTAACCTAGGTTGGTGGATGGTCGAAATGAATCTT
TTCGGTTTCAGTACAGATGTTAGTGATGAATGTATAAAAGATTTAGCAATTGCAATAGGC
AAATTAAAATCACTGACAGAACTCGACTTAAACTTTGACAGATGGGGTTATAAAAATAAA
TTTATCAAAGATGAAAGCATAATCAATTTAGCAGAAAACATTGAGAACCTATATGCTTTG
AATAGTCTTTCTCTTAATTTTGATTGGTGGGGATTAGGTAATGAGAAAATAACTGACAAA
AGTTTAGTTTAACTAGCAAATAAAGTTACTAAGCTAAGCAAGCTTACAACCTTAAGGTTA
TTTTTAAGTCTCGATAGATGGAAAAAGATTGAAGAAAAACATATTGAATGCTTCAAAGAA
AAAATAATGACATTAAAAACTTTCAATAAAAACATTACTATAGATATCAAATGA


>TTHERM_00396960(protein)
MNNIPADRCEQKSLDEQGKSDIDEENNQKNLYNQISGLEAQFLQYDRNDNFNERYEEEEK
TITNNNEFSNTYQLETKKDETIDSNSIIDGSSNTSSSQIWNGSRVQDGLEQIYTNKKMMK
RDSLKQQVLNNQHQFSRRQSFNPHQSMLNYSQFCPKRSSLLGNSFPLQITSQEQFSSQFS
NQKTMQTQSRTNLQINGVKNHKFEEQNQAISSISTSIQNFQNLESSVSLSRSKKVIKISK
DKIEARVKQQLLQAQTLGSISSTNSFDDSPITRINKGSTKLHLIQNHQQQKGTFKSQQLL
FLPLSNINDPKRISICLHEDMAEEYNKFMMMNNPNQPSQISQIKSKNQNTLSEASICGNT
VFEENEDVLSGVINSSDQEQTQYTITENNITEQSDSSNSSSQINTPSPIEIKTTKQRVHQ
FYTEQCLDKAQRKKQITNQHGSSFKNKYMSKTIPSIDDYEENEEEIKFNETVLLKTEKQI
INPSDKSDKKEKKSNETKRISKDEYSSNQTNKKQFIQDQTEYMYRSNNKIEKPEPNKNHS
NQAAAKQIDSRINTKNHNSNVKVVENHNGYGFNPNQKVNIEDYNIGLVYGGDLKRQENKE
KICNILLSKQYSDLLEIGSGSYGLVLRATTPEGYIRALKIHYGITQDESAFLDRLNTLTA
NSIMAYNTFKFRDTVSKKQIEVIEMELADGSLKNQVYADESEISDEKYRQICIQLIVNVL
SMHNMCVVHRDLKLDNILVSNGNYFLADFGISEEIGSHQLTQNFIPGTDCFSIKQNIAGT
QLYFSPIIRDAHSAQPKKYIIEHDPFKSDLYTVGLILLEIELVRQKYQRHQIQQILRDKH
QAYKYALKMNINKYLIKDNYYILKNRLYKPINILAELLQIEEINRISSIKLCLICQLDKI
ILSNIIVPHHKIFPPIIELKQDNTCIINYTIKLLIYEGSYIKMEDGRILRHGEGSLYKLI
EGEREVIKALVYEGQWDNDLPHGYGVFYFFQNDWVYEGQFRNGQFFGEGSIKFIDWVVYK
GTWYNFLLEDFLIPVIPTDSDLFLQKDQKNVEVLINTHDREGYMKSTGLNEVELQFEINT
FRFYSSNFIEFKQYLKDKQRVKILLTSKKSKHDFQQSSRQQLVLLAVNRRKKRIFEVYIK
YFKHELILDAVILEQLIQLLNQPSQLGKNSSDFCNESSNKLNIQKQQIQETSLMVSENNL
SESDRLSSFQSSLSSNYNSSNQVCSIDDSDSIIYLNFDLFSKESAVYFFDKISNKNDPSL
SIFKLEYMKNIGVSAQIEEESLIKFLLSKQVQNLKELDLSSSKDISSSIFVALDHNIESL
KMLNLKYEALSQQTFCSLFKYPFLKQIVILDFSYSEFDDKCMLELVSCPYLNNIQILIFC
FCRNLTHKGLEIFLQKSSHENFPQLTQLDFEGILSKGYHNMKNDKILTKISSQGNIQNIN
YENIHQTEQEMLLAFDRKHHLYSNNSNLTILDQKLVQQSAGSAVSIDCINSSVRSLNKEQ
QNNLIKQNAYFHYFPYTTDNILKQLEYIQKYNILRKNLVELNQSDAHSSLTSCGNLTSAI
QISNCDETNNQQPQQHETIKQQISDQNIKSQQLIKATIQSNQNISFNTQHQAFHSSISNL
SLTNLNNCSSPHSNKNININQKVQSKQSQSSSFFNWVNKLTDKNLQAFEKFSKQTKLFGI
QILSFRATNIDDTVLKNLAKNSSFIYLKFLDISQCQQILSEGFESLIQSNYLKNLIKIDI
SQTNIISITSKKPQQVFLQSLNLVECPNLSPQSVFNYLSNIQNQQNIRQLYIDSDIFFVA
QIKQCLLECQKLQNIHIFVSSNKVDFFIQNPLTLHLLIEKKGYKLNFYSSKLYIQSLFEL
VKSQVIQCIQIKKEQLNQIFINGTSYVDLSRFDHQSTPDYEQDTIQINRAQMLDIPSKNI
SFEQLNDENIIEDLRKLFNSRNFLLIKQLDISRLKVNSYAGQLLAGSRYTRSLTYIDLSY
STIIDEDLDKLSKSKYLPQLQVIKLNCCKDITEKGINYLLNTQNSLENLKTIEVKQRLLN
IYLLYSQNSEKIQIIADQILFKYELNQLRNHNNHHKVFQFAKYWTKIFRDNMQNINSIEI
LGFDENIIDYFLTHITSRNRVKKVIIDFSKKNQKIQSQSQIQNINQFQRINHIFSKLPDL
QELRLDFSGWSDMTDLSIKEFCESIVGLQNLKVIDINLSEWAKENEQITDLSCMFLGEIF
QKIQKINVVSLDLSNWGDGNCKITDKSIVYLQKGILCTKDYLTYLSLNLNSWGSQMTNTS
LINLHDLVRELNLLSFLKLGLQEWGKDNSSINDDGIESLAIAIGNSRFLNQLEINLAYAA
TLNSGIGDVSVQNLAKSLMNINSLSSLKINLGWWMVEMNLFGFSTDVSDECIKDLAIAIG
KLKSLTELDLNFDRWGYKNKFIKDESIINLAENIENLYALNSLSLNFDWWGLGNEKITDK
SLVQLANKVTKLSKLTTLRLFLSLDRWKKIEEKHIECFKEKIMTLKTFNKNITIDIK


>TTHERM_00396960(gene)
ATGAACAATATCCCAGCAGACAGATGTGAGTAAAAATCGCTTGATGAACAAGGGAAAAGT
GATATTGATGAAGAAAACAACTAAAAAAATCTTTATAATTAAATCAGTGGCCTTGAAGCA
TAATTTTTATAATACGATCGCAATGATAATTTTAATGAAAGATATGAAGAAGAAGAAAAA
ACGATTACAAATAATAATGAGTTCTCAAATACATATTAATTAGAAACAAAGAAAGATGAA
ACAATAGATTCTAATTCAATCATTGATGGTTCATCAAATACCTCCTCCTCTTAAATTTGG
AATGGAAGTAGAGTTTAAGATGGATTAGAATAAATTTACACAAATAAAAAAATGATGAAA
AGAGACTCTCTAAAGTAGCAAGTATTAAATAATTAGCACTAATTTAGTAGAAGATAAAGC
TTTAATCCACATTAATCAATGCTTAATTATTCATAATTTTGCCCAAAAAGAAGCAGCCTT
TTAGGAAACTCTTTTCCTTTACAAATCACAAGCTAAGAGTAATTTTCAAGTCAATTTTCT
AACCAAAAAACTATGCAAACTTAAAGCAGAACAAATCTATAAATTAATGGGGTCAAAAAT
CATAAATTTGAAGAATAAAATCAAGCTATTTCTAGCATTAGCACAAGCATTTAGAATTTT
TAAAATTTAGAGAGCAGCGTTTCTCTAAGTCGCTCTAAAAAAGTTATTAAAATTTCTAAA
GATAAAATAGAAGCAAGAGTTAAGCAGTAACTTTTACAAGCTTAAACTCTTGGCAGTATT
TCTAGCACAAATTCATTTGACGATTCTCCTATTACAAGAATAAATAAGGGAAGTACAAAG
TTGCACTTAATACAAAATCATCAACAATAAAAGGGAACATTTAAAAGCCAATAGCTGCTA
TTTCTCCCACTTTCAAATATAAATGATCCAAAAAGAATTTCGATATGTCTTCATGAGGAT
ATGGCTGAAGAATACAATAAATTTATGATGATGAATAATCCAAATTAGCCTTCTTAAATT
TCTTAAATTAAATCTAAAAATCAAAACACTCTCTCTGAAGCTAGTATTTGTGGTAACACT
GTTTTTGAAGAAAATGAAGATGTTCTATCAGGAGTTATAAATAGCTCAGATTAAGAATAA
ACACAATACACAATCACTGAAAATAACATAACAGAATAAAGTGATTCTTCAAATTCTTCT
TCTTAAATTAATACACCTTCTCCTATTGAAATAAAGACTACTAAGCAAAGGGTACATTAG
TTTTACACAGAACAGTGCTTGGATAAAGCTTAAAGGAAAAAATAAATAACAAATTAACAT
GGTTCATCTTTTAAAAATAAATACATGAGCAAAACAATACCTGTAATGACAATAAAATTT
ATTTATTTAGCTTTTTAAATGTCAAAATTTATTTAACTGAACTTATTTATTTTCTTTTTA
AATTAAGAGCATTGATGACTACGAAGAAAATGAAGAGGAAATTAAGTTCAACGAAACAGT
TTTGCTTAAAACTGAAAAGTAAATAATAAATCCAAGTGATAAAAGTGATAAGAAAGAAAA
GAAGTCAAATGAAACTAAAAGAATTTCAAAAGATGAATATTCATCAAATTAAACAAACAA
GAAATAGTTTATTTAGGATCAGACTGAGTATATGTATAGAAGCAATAATAAAATAGAAAA
GCCTGAACCAAATAAAAATCATAGCAATTAAGCAGCTGCAAAATAAATAGATTCTAGGAT
TAATACAAAAAACCACAACAGTAATGTGAAAGTTGTAGAAAATCACAATGGATATGGTTT
TAATCCAAATTAAAAAGTAAATATAGAAGATTATAATATAGGATTGGTTTATGGCGGAGA
CTTGAAGAGACAGGAAAACAAAGAAAAAATATGTAATATTCTATTGAGTAAGTAATATAG
CGATCTTCTAGAAATAGGAAGTGGGTCGTATGGACTTGTTTTGAGAGCTACAACACCAGA
AGGATATATCAGAGCTCTTAAAATACATTATGGAATTACTTAAGATGAATCTGCGTAAAT
TTATAAATAACAAAAAGAAATTTAATGGTTTTTTTCATATAATAAAATAAGTTTCCTAGA
TAGACTTAATACTTTAACTGCAAATAGCATAATGGCTTATAATACATTTAAATTTAGAGA
CACGGTTAGCAAGAAATAGATAGAAGTTATAGAAATGGAGCTTGCAGATGGTTCTCTAAA
GAATCAAGTGTATGCAGATGAATCAGAAATCAGTGATGAAAAGTATCGGTAAATATGTAT
TTAACTTATTGTAAATGTGCTCTCAATGCATAATATGTGCGTAGTGCATAGGGATTTGAA
GCTAGATAATATTTTAGTTAGTAACGGGAATTACTTTTTAGCGGATTTTGGTATATCTGA
AGAAATAGGCAGTCATTAGTTAACTTAAAATTTTATTCCTGGAACTGATTGCTTTTCAAT
AAAGCAAAATATAGCAGGAACATAGCTTTACTTTTCTCCTATAATAAGGGATGCCCATTC
AGCTTAGCCGAAAAAATACATTATCGAGCACGATCCCTTCAAATCAGACCTATATACAGT
AGGTCTAATTTTACTAGAAATTGAGCTAGTAAGATAAAAGTATTAAAGACATTAGATACA
ACAGATTCTCAGAGACAAGCATTAGGCTTATAAATATGCTCTCAAAATGAATATAAACAA
GTATTTAATAAAAGATAATTACTACATCCTAAAAAACCGTCTCTATAAGCCAATAAACAT
ATTAGCAGAGCTTCTTTAAATTGAAGAAATTAATCGAATCTCTTCTATAAAGCTTTGTCT
TATTTGTCAGTTAGATAAAATTATCTTAAGCAACATCATAGTCCCTCATCATAAGATTTT
TCCTCCTATTATTGAATTAAAGTAAGATAATACTTGCATTATTAACTATACTATAAAGCT
ACTTATTTATGAAGGTAAACTAAAAAATTATTTCTCAAATAAATCATTTAATACTTATTT
AACTAAGGGTCATATATTAAGATGGAAGATGGGAGAATTCTACGACACGGAGAAGGTAGA
TTTTTTGATATTTGAGTTTTTCAACGATTAAAGGATTTATTTAAATATAATTTTGATAAT
AAAAGGGTCTTTGTATAAACTAATTGAGGGAGAAAGAGAGGTTATCAAAGCTTTAGTTTA
TGAGGGATAATGGGATAATGATCTTCCTCATGGTTATGGTGTATTTTATTTTTTTTAGAA
TGATTGGGTGTATGAAGGTTAGTTTAGAAATGGATAATTTTTTGGAGAAGGAAGCATAAA
ATTTATAGACTGGGTTGTTTATAAAGGAACATGGTATAATTTTCTTCTTGAAGATTTTCT
AATACCTGTAATTCCGACTGATTCTGATTTATTCTTGCAAAAAGATTAGAAAAACGTAGA
AGTTTTGATAAATACTCATGATAGAGAAGGATACATGAAAAGCACTGGGCTGAATGAGGT
GGAACTGCAGTTTGAAATTAATACTTTTAGGTTTTACTCAAGTAATTTTATTGAGTTTAA
GCAGTATTTAAAGGATAAATAAAGAGTAAAAATACTTCTAACATCTAAAAAGAGCAAGCA
TGACTTTTAATAAAGCTCCCGCTAATAGCTGGTGCTACTGGCTGTTAATAGGAGAAAAAA
AAGAATATTTGAGGTTTACATCAAGTACTTTAAGCATGAGCTTATACTAGATGCCGTGAT
TTTAGAATAACTTATTTAATTACTCAATTAACCTAGCTAATTAGGAAAAAATTCTTCAGA
TTTTTGTAATGAAAGTAGCAACAAATTAAATATTCAAAAATAATAAATCTAAGAAACTTC
TTTGATGGTATCAGAAAACAATCTTAGTGAATCTGATAGACTCTCATCATTTTAATCATC
ATTATCGTCAAATTACAATAGCTCAAACCAAGTTTGTTCTATTGATGATTCTGATAGCAT
AATTTATTTAAATTTTGATTTATTTAGTAAGGAAAGCGCAGTCTATTTTTTTGATAAAAT
TTCTAATAAAAATGATCCTTCGCTTTCCATTTTTAAACTAGAGTATATGAAAAATATTGG
TGTTTCTGCTTAAATTGAAGAAGAAAGTCTGATTAAATTTTTACTCTCTAAGCAAGTTCA
AAATCTAAAAGAATTAGATCTTTCAAGCTCGAAGGATATTTCCTCTTCCATATTTGTAGC
TCTGGATCATAACATAGAGTCTTTGAAGATGCTCAACTTAAAATACGAAGCTCTATCTCA
GCAAACATTTTGCTCACTTTTTAAATATCCTTTCCTAAAATAAATTGTGATTTTAGACTT
TTCTTACTCTGAGTTTGATGATAAGTGCATGCTTGAACTAGTATCATGTCCTTACTTAAA
TAATATTTAAATCCTGATATTTTGCTTTTGCAGGAACTTAACACACAAGGGCTTAGAAAT
TTTCTTATAAAAGTCATCACATGAAAACTTTCCTCAACTCACTCAGTTAGATTTTGAAGG
TATTTTGTCAAAGGGTTATCATAACATGAAAAATGATAAAATATTAACAAAAATTTCTTC
TTAAGGAAACATACAAAACATAAATTATGAAAATATTCATTAAACAGAATAAGAGATGCT
TCTTGCTTTTGATAGAAAGCATCATTTATATTCAAATAACTCCAATTTGACTATATTGGA
TTAAAAGCTAGTCTAATAATCAGCTGGTAGTGCTGTATCTATTGATTGTATCAATAGCTC
TGTTAGGAGTTTAAATAAAGAATAATAAAATAATTTAATTAAATAAAATGCATATTTCCA
CTATTTTCCTTACACTACTGACAATATCCTTAAATAACTCGAGTATATATAAAAGTATAA
CATTCTTAGAAAAAATCTAGTTGAGCTAAACTAAAGTGATGCTCATTCTTCATTAACTTC
ATGCGGAAATCTCACTTCAGCCATTTAAATTTCTAACTGTGATGAAACAAATAATTAGCA
ACCTCAACAGCATGAAACTATCAAATAATAAATTTCTGATTAAAATATTAAATCTCAATA
GCTTATAAAAGCAACCATTTAATCTAACCAAAATATCTCTTTCAATACTTAACATTAAGC
CTTTCATTCATCTATTTCAAATTTGTCGTTAACAAATTTAAATAACTGCTCATCGCCCCA
CTCAAATAAAAACATCAACATTAATTAAAAAGTTTAATCAAAATAGTCATAATCATCTTC
CTTTTTTAATTGGGTCAATAAATTGACAGACAAAAACTTATAAGCCTTCGAAAAATTTTC
AAAATAAACAAAACTTTTCGGCATACAAATTTTAAGTTTTCGAGCAACAAACATAGACGA
TACTGTTTTGAAAAATCTAGCAAAAAACAGTAGTTTTATTTATTTAAAATTTTTAGATAT
TTCACAATGCTAATAAATATTAAGTGAAGGATTCGAAAGCTTAATTTAATCAAACTATTT
AAAAAATTTAATTAAAATTGACATTAGCCAAACTAACATCATTAGTATAACCTCGAAAAA
ACCACAACAAGTATTTCTATAATCCTTAAATCTTGTTGAATGCCCAAATTTATCTCCTCA
AAGCGTATTTAACTATTTATCTAACATTCAGAACTAGTAAAATATAAGGCAACTCTACAT
CGATAGTGATATTTTCTTTGTTGCATAAGTAAAACATATTTTTTTATTTATTTATTTGTT
CATCAAATTTTTGTTATTAAATTAGATTAAGCAGTGCCTGCTAGAGTGCTAAAAGCTTTA
AAATATCCATATTTTTGTCTCTTCAAATAAAGTTGATTTTTTTATACAAAATCCTTTAAC
TTTGCATTTATTGATTGAGAAGAAAGGATATAAATTAAATTTCTATTCTAGTAAATTATA
TATTCAGTCGCTTTTTGAATTAGTGAAAAGTTAAGTGATTCAATGTATCTAAATTAAGAA
AGAGTAGCTAAATTAAATCTTCATAAATGGCACTAGTTATGTAGATTTAAGTAGATTTGA
CCATCAATCAACACCTGATTATGAACAAGATACAATCTAAATTAATAGAGCTTAAATGCT
TGATATTCCTTCTAAAAATATTTCTTTTGAATAATTAAATGATGAAAATATTATTGAAGA
TTTAAGAAAATTGTTTAACTCAAGAAACTTTTTGCTTATTAAATAATTAGATATTTCTAG
ACTTAAAGTTAATAGCTATGCAGGATAGCTTCTAGCTGGCTCAAGATATACAAGATCTTT
AACTTATATTGATTTAAGCTATTCTACAATAATAGACGAGGATCTTGATAAGCTAAGCAA
ATCTAAGTATCTTCCCTAGCTATAAGTAATCAAGTTAAACTGCTGTAAAGATATTACAGA
AAAAGGAATAAATTACTTATTAAATACCCAAAACAGCTTAGAAAATTTGAAGACTATTGA
AGTAAAACAGAGGCTACTCAACATATATTTACTTTACTCGTAAAACTCAGAAAAAATCCA
AATAATTGCTGATTAAATACTTTTCAAATATGAGCTAAATCAACTTAGAAATCATAACAA
TCACCATAAAGTCTTTTAATTCGCTAAGTACTGGACGAAGATTTTTAGAGATAATATGTA
AAATATAAACTCAATAGAAATATTAGGATTCGATGAGAATATAATTGACTATTTCTTGAC
CCATATAACAAGCAGGAATAGAGTTAAGAAAGTCATTATTGATTTCTCTAAAAAGAATCA
AAAAATTCAATCTTAATCCTAAATCTAAAATATCAACTAATTTTAAAGAATTAACCATAT
TTTTAGTAAACTGCCAGATCTTTAAGAACTTCGTTTAGATTTCTCTGGGTAAATTAAAAA
TGCTTTTTTATGAATTCTTAATTTTAAAATTATTTGAAAAATTAATTAACAAAGGTGGAG
TGATATGACTGATTTATCAATTAAAGAATTTTGTGAAAGTATTGTAGGACTGTAGAACTT
AAAAGTTATAGATATAAACCTTTCAGAATGGGCAAAAGAAAATGAATAAATCACCGATTT
ATCGTGCATGTTTTTGGGTGAAATTTTTTAGAAAATCTAAAAGATAAACGTAGTAAGTTT
AGATCTCTCTAAGTAAATTCATTTCTAAAAAAGATATATCTAATTAATTAATTTTGGGTG
TGTTTTTGTTTAAATTTATTTATTTTTTAAAAGTTGGGGAGATGGCAATTGCAAGATTAC
TGATAAATCAATAGTATATTTGTAAAAAGGTATTCTTTGCACAAAGGACTATTTAACTTA
TCTATCTTTGAATTTGAATTCGTGGGGTTCATAGATGACTAACACTTCACTTATCAATTT
GCATGATCTAGTCAGAGAACTCAATCTCTTGAGTTTTTTAAAGTTAGGTCTTTAGGAGTA
TATTTTAATTATTTATTTTAAAAGAAATTTCAAATAAATTATTTGATTTAGATGGGGTAA
AGATAATTCCAGTATTAATGATGATGGAATAGAATCATTAGCGATTGCGATTGGTAACTC
AAGATTTCTGAATTAATTAGAAATAAATTTAGCCTAGTAAGATTGTTTGTTAAAATTTTA
AATTATTTACTTATTTTAATGTGATCAAAGTGCAGCGACTTTAAATAGCGGAATTGGAGA
TGTGAGTGTCTAGAATCTTGCAAAAAGTTTGATGAATATCAATAGTTTAAGTTCTTTGAA
AATTAACCTAGGTTGGTGGATGGTCGAAATGAATCTTTTCGGTTTCAGTACAGATGTTAG
TGATGAATGTATAAAAGATTTAGCAATTGCAATAGGCAAATTAAAATCACTGACAGAACT
CGACTTAAACTTTGACAGGTAAGTTTTTGTTTATTTTTTAAACTTTTAAAAACTTTTATT
TTTAATAAAGATGGGGTTATAAAAATAAATTTATCAAAGATGAAAGCATAATCAATTTAG
CAGAAAACATTGAGAACCTATATGCTTTGAATAGTCTTTCTCTTAATTTTGATTGGTAAG
TTGGTTGATTGTTTAAAGTATTTTTATTAACATCATTTAAAATAAATAGGTGGGGATTAG
GTAATGAGAAAATAACTGACAAAAGTTTAGTTTAACTAGCAAATAAAGTTACTAAGCTAA
GCAAGCTTACAACCTTAAGGTTATTTTTAAGTCTCGATAGGTAAAAAAACTTAATTACTC
TTATATATTTATCTATTTAATTATTTAAATATAAATTTAGATGGAAAAAGATTGAAGAAA
AACATATTGAATGCTTCAAAGAAAAAATAATGACATTAAAAACTTTCAATAAAAACATTA
CTATAGATATCAAATGA