Identifiers and Description

Gene Model Identifier

TTHERM_00823370

Standard Name

MRNO02 (Membrane Occupation and Recognition Nexus protein other)

Aliases

PreTt20411 | 141.m00068 | 3682.m00002

Description

Protein with predicted MORN domains localized throughout the protein and/or associated with other domains having a predicted function

Genome Browser (Macronucleus)

GBrowse

Genome Browser (Micronucleus)

GBrowse

Gene Ontology Annotations

No Data fetched for Gene Ontology Annotations

Domains

  • ( PF02493 ) MORN repeat
  • ( PF03489 ) Surfactant protein B
  • ( PF09283 ) CDC13, ssDNA binding
  • ( PF07676 ) WD40-like Beta Propeller Repeat
  • ( TIGR00136 ) tRNA uridine 5-carboxymethylaminomethyl modification enzyme

Gene Expression Profile

  • Tetrahymena Functional Genomics Database:

Change in Gene Expression

TMHMM

TMHMM

Signal Peptide

Signal Peptide Present?: No
Presense Probability: 10.3%

TetraMine Data

TTHERM_00823370

WebApollo

Fullscreen View

Tetrahymena Stock Center

No Data fetched for StockID

Homologs (v.2006 protein sequences)

SourceIdentifierScoreDescription
Tetrahymena borealisEI9_18183.19.997093137033517e-262hypothetical protein (1344 aa)

General Information

No Data fetched for General Information

Associated Literature

No Data fetched for Associated Literature

Sequences

>TTHERM_00823370(coding)
AAACAAGCCAAATTTTACTACTTTTTTAATTCTAAGCCAATAAATTATTAGTGGCAAAAT
AAACAATAAATAAGCTTTTGTTATTTTGGTTTATATAAAATGTATAAATCAGATTAGATA
AATTAATCACTCAAAAAGAACTATCGCTATGACTTCAAAAATGGGATTTTCGAAGGTAAT
GTGGTTTAATACAAAAGATAGGGCTTTGGCATTGCAATCCTCGATGATGGATACATTTAC
ATTGGATATTGGCATAATGATAAAGTTCATGGAAAAGCATTAATATTCTTGCCAAATATA
GGAGTTATTTTAGCAAATTTTTCAAAGGGAATGCAGGTTGGTATTTAAGTAGTAAAGCTT
TATAAGTTTTCTAATGAATACTTCTGTGTCAATATTAAAGATCATTTAAAGGTTCCAAAA
GAAGTTGTTATTTTCTCTAAGCTTACAAATAAATCAGTTTAAGCATTAATCAAAAATGAA
AGACAAATAGAATTCAAAGAAATCATATTGTCTAAAGAATACGAAGAATTAATTTAATAA
TTAGATTAATTTTCGATGCAATTTTCAAGTGATTTTAAAATTACCAAATGTTTTAGTATT
GATGGTGATAAGTAAATTAAGCTAGGTTTTGTTGGTGGAAATCACAATAGATTAAATGGC
TTGGGTTTAATAATAGAGTAAGATAGTTACAAAATAATTAAGCAAGGACTGTTTGATGAA
GATAAACTAGAAGGAGTTGGAAAATTAGTTATGCCAAATGACGATGTGTATGAAGGGATA
TTTAAAAATAACTAAATAGATGGCCAAGGATTTTATTTCACAGCAAAGACTAACTCTTAC
ATTTAGGGTGTTTTTAAAAAAGATGTATGTAAGGAATTCATTCAAGATGGTTTGGAATAT
CCTTTGAATCAAATAAAAAAGTTTAAACAGTAAATACATGAGTGCAGTATTCATTTTTAT
TCTTCCTCGTTCTCTGCAAGAGACTTTATAAGCATTAATTGGAATTATTTATAAGATTAC
ATGGACAAGTCAAAGTACATGCCTATATTTGTAGATGGAAATTCCTCATCAGGCTTAACC
AGCTTACTTGATAAAAATTAAAGTACAAATAATAATTTTTATAGAAGTGATGAATACTAA
TAGACATTTTAAGCAAATAATTAATAAATCAATAGCAGCAAATTAAATACATGCTAAATG
ATAAGCTCTTCTTTTAATAAATATTAACCACATATTACATAAAGAAGAAGTAGTAGTATT
AACGAATACAGAAATTAACTCCCTACATACCATCATAGCAGATTGAACTCTCTTAATGTA
AGTTAGAATTTTGGAAAAAATGGATTTTTAAATAGCTCTAATAGAACATCTTAAACACAA
ACTAGCCAAAAATATTCAACTAAGTACACAATAAGCTATAGAGATCATTAAATTGAAAAT
CCAGAATAGCAGCTTTCTAACTCAAAGATTAACTTTGGGAAATTAAATTGGGGGTAAAAA
CCAGAGGCTTCTGATTTATCTTTTTCATACACTAATTTTAATGTTAATAAAGAAGGTTAA
AATTTGTATGATCTTCTAAATAACGACGAGACTTATCAAAAAGAGTCAAAAATTAATTAC
TTTAAGAACTCAGGTAAAATTCCTTCCTATTAGGACACAATGTAGGAAGGTGAAATAATT
AAAAAAAGGCTTAATGAAATGGCTGATTTTGACAATTGCAATGTGTCTAACAACGACAGC
GAAAAAAAAATATTAGAATCAGTTTAATAGATAAAAATAAATTCTATATCTCAACCTGTT
ACTTATAGATCAGTTAATACAACAACCCCTCTTTAAGCAAGATAAATTGAAAGATAGTAG
AATTCTATAGATTCTTAAAAAATGAATAGAAGATTTAGCAATTAAAATTATACATATAAT
ATTGAAGATAATTTCTAAATAAAAGAAAACACACAAGACCCAACAAAAATTTAAAGTATT
TCTGACTATCTGAAAAATGTAGCAGAAAATAACCAAGAAAGCTATTTAAATCAAAAAATA
GATTCATGTGATTTTAGATATAACAAAAATGGTAGAAATCTCATTCCATATAATCCCAAC
CAATATGGTAAAGATTTTATTAGGTAGGGTTGTGAAACATCGCAATCTGATTATTCAATA
CAATAGTATGAAGCCAAAAAGAGGTCAAGCTCTCTAACTACTCCTAATACAATAGTTTCC
GTTTCCAAATCAAGTGCTAATTGCTATGATAAAAGATTAGAAATTTCACCAGAAAGAGTA
ACTCTTTCAATAGATAAAGGATTAAACTCAAGTAACATTTAATGTGCATTAAATCAGTAG
ATAAATAAAAATAATGAAAACATAATAAAACTTTAAAACCTTTATGAAGACAGATTGAAG
AGAAGCGATACAAATATTTTAGAATAAGAAGATTCATCAAAGAGCGAGGATATTTAGAAA
AAATAACCATAATAGCCTAAAAAATAACAGTTAAATGACTAAAAATAATAAAATAATTCT
AATTAATGTTAATAATTACTATCTTAGTCCTCCTTAACATAAAATAATACTCAACCTATG
AAATTTATAAAGGTACTTGGAGTGCCTCATTCCAATAAAAGTGATCAAGTTGGAATTTTT
TTGAAGATGAAAGAAGAAGCTATAAAATAGAAAGAATTGCAAACAAATTCAATATTAGAA
TAATAAAATTCCATTTAAAAAATTTAAGAGATCACTCCATAGATTGCTCGTAATGCTAAC
AAAATAGCTTCTTAAAATTCTCTTGGGGTATCTATTTTGGAATAGTACATGAATCCAGAG
AGTTGTGCTATCAAAAAAAGTGATAAAAATAGTTAGAAATAAAACAAATCTTATCAGTTT
TAAGCTAATTAAAATGGCAATAATAACTTAGAAAATATAAATAAATAAAATCAAATAAAT
AATGGTTATTATTTACCTTAAGAAAAAAACGATTAAAAACCAATATCACCAGGTAATTAA
AATTAATCTAGCATGCTAAGTAATAATCCATATAATCAAATACAAAATGAATTTGAGCAG
AACTTATAATAAATACCTAAACAATAGCTTGATATATTGTAAGAATAAAAAATAAAATTA
AACAGCATACTTTATTCTAGAAAGTAATCATATAATAATAATTAAAATTTATAAGATTTA
CCATCAGCTAGACTTTCTGGATATTCAGTTGGAATTACAAGTTAATATGACAACAAAAAT
ATATTTAACTAAAATAGTAATTTAAATACCTTACCTATTAATGTTAGAACCCAATCAACT
GATAATTCACCTTATAACATATCAAAAACCAATCCTAATGAAATAGATGACTTAGAATTT
AAAACAAAATCTATGGTGAGATTTAATTTAAACTCAGACACTCCTCAAAGACATTCTTCA
TTCAATTATAGAAGGTAATAAACACCAGAAAAATCATCTCTCAAAGGAAGTAACAAATCA
CATCTAAATAGCAACTTAAGTTGCACTTCAAACGAAAGTGATTAGAAGGTAAGTAAAAGA
CTATCAACTTCTATAGATTTATCTAATAGTAAATATCACTATAATGAAAACCCAGTAAAT
TTATTTTATATGAACACACTTTAAAAAACCTAAAACCAGTGGTTGGATTTATATTCTGTG
AACCCATAGATATTAGCCAATGCATCTCCTTAAAAATATTAAAAAAGCAGATAGATTTAA
AACAACCAATAAATTCAACAATAGTGTCTTCCTCAAATAGCATGA


>TTHERM_00823370(protein)
KQAKFYYFFNSKPINYQWQNKQQISFCYFGLYKMYKSDQINQSLKKNYRYDFKNGIFEGN
VVQYKRQGFGIAILDDGYIYIGYWHNDKVHGKALIFLPNIGVILANFSKGMQVGIQVVKL
YKFSNEYFCVNIKDHLKVPKEVVIFSKLTNKSVQALIKNERQIEFKEIILSKEYEELIQQ
LDQFSMQFSSDFKITKCFSIDGDKQIKLGFVGGNHNRLNGLGLIIEQDSYKIIKQGLFDE
DKLEGVGKLVMPNDDVYEGIFKNNQIDGQGFYFTAKTNSYIQGVFKKDVCKEFIQDGLEY
PLNQIKKFKQQIHECSIHFYSSSFSARDFISINWNYLQDYMDKSKYMPIFVDGNSSSGLT
SLLDKNQSTNNNFYRSDEYQQTFQANNQQINSSKLNTCQMISSSFNKYQPHITQRRSSSI
NEYRNQLPTYHHSRLNSLNVSQNFGKNGFLNSSNRTSQTQTSQKYSTKYTISYRDHQIEN
PEQQLSNSKINFGKLNWGQKPEASDLSFSYTNFNVNKEGQNLYDLLNNDETYQKESKINY
FKNSGKIPSYQDTMQEGEIIKKRLNEMADFDNCNVSNNDSEKKILESVQQIKINSISQPV
TYRSVNTTTPLQARQIERQQNSIDSQKMNRRFSNQNYTYNIEDNFQIKENTQDPTKIQSI
SDYLKNVAENNQESYLNQKIDSCDFRYNKNGRNLIPYNPNQYGKDFIRQGCETSQSDYSI
QQYEAKKRSSSLTTPNTIVSVSKSSANCYDKRLEISPERVTLSIDKGLNSSNIQCALNQQ
INKNNENIIKLQNLYEDRLKRSDTNILEQEDSSKSEDIQKKQPQQPKKQQLNDQKQQNNS
NQCQQLLSQSSLTQNNTQPMKFIKVLGVPHSNKSDQVGIFLKMKEEAIKQKELQTNSILE
QQNSIQKIQEITPQIARNANKIASQNSLGVSILEQYMNPESCAIKKSDKNSQKQNKSYQF
QANQNGNNNLENINKQNQINNGYYLPQEKNDQKPISPGNQNQSSMLSNNPYNQIQNEFEQ
NLQQIPKQQLDILQEQKIKLNSILYSRKQSYNNNQNLQDLPSARLSGYSVGITSQYDNKN
IFNQNSNLNTLPINVRTQSTDNSPYNISKTNPNEIDDLEFKTKSMVRFNLNSDTPQRHSS
FNYRRQQTPEKSSLKGSNKSHLNSNLSCTSNESDQKVSKRLSTSIDLSNSKYHYNENPVN
LFYMNTLQKTQNQWLDLYSVNPQILANASPQKYQKSRQIQNNQQIQQQCLPQIA


>TTHERM_00823370(gene)
AAACAAGCCAAATTTTACTACTTTTTTAATTCTAAGCCAATAAATTATTAGTGGCAAAAT
AAACAATAAATAAGCTTTTGTTATTTTGGTTTATATAAAATGTATAAATCAGATTAGATA
AATTAATCACTCAAAAAGAACTATCGCTATGACTTCAAAAATGGGATTTTCGAAGGTAAT
GTGGTTTAATACAAAAGATAGGGCTTTGGCATTGCAATCCTCGATGATGGATACATTTAC
ATTGGATATTGGCATAATGATAAAGTTCATGGAAAAGCATTAATATTCTTGCCAAATATA
GGAGTTATTTTAGCAAATTTTTCAAAGGGAATGCAGGTTGGTATTTAAGTAGTAAAGCTT
TATAAGTTTTCTAATGAATACTTCTGTGTCAATATTAAAGATCATTTAAAGGTTCCAAAA
GAAGTTGTTATTTTCTCTAAGCTTACAAATAAATCAGTTTAAGCATTAATCAAAAATGAA
AGACAAATAGAATTCAAAGAAATCATATTGTCTAAAGAATACGAAGAATTAATTTAATAA
TTAGATTAATTTTCGATGCAATTTTCAAGTGATTTTAAAATTACCAAATGTTTTAGTATT
GATGGTGATAAGTAAATTAAGCTAGGTTTTGTTGGTGGAAATCACAATAGATTAAATGGC
TTGGGTTTAATAATAGAGTAAGATAGTTACAAAATAATTAAGCAAGGACTGTTTGATGAA
GATAAACTAGAAGGAGTTGGAAAATTAGTTATGCCAAATGACGATGTGTATGAAGGGATA
TTTAAAAATAACTAAATAGATGGCCAAGGATTTTATTTCACAGCAAAGACTAACTCTTAC
ATTTAGGGTGTTTTTAAAAAAGATGTATGTAAGGAATTCATTCAAGATGGTTTGGAATAT
CCTTTGAATCAAATAAAAAAGTTTAAACAGTAAATACATGAGTGCAGTATTCATTTTTAT
TCTTCCTCGTTCTCTGCAAGAGACTTTATAAGCATTAATTGGAATTATTTATAAGATTAC
ATGGACAAGTCAAAGTACATGCCTATATTTGTAGATGGAAATTCCTCATCAGGCTTAACC
AGCTTACTTGATAAAAATTAAAGTACAAATAATAATTTTTATAGAAGTGATGAATACTAA
TAGACATTTTAAGCAAATAATTAATAAATCAATAGCAGCAAATTAAATACATGCTAAATG
ATAAGCTCTTCTTTTAATAAATATTAACCACATATTACATAAAGAAGAAGTAGTAGTATT
AACGAATACAGAAATTAACTCCCTACATACCATCATAGCAGATTGAACTCTCTTAATGTA
AGTTAGAATTTTGGAAAAAATGGATTTTTAAATAGCTCTAATAGAACATCTTAAACACAA
ACTAGCCAAAAATATTCAACTAAGTACACAATAAGCTATAGAGATCATTAAATTGAAAAT
CCAGAATAGCAGCTTTCTAACTCAAAGATTAACTTTGGGAAATTAAATTGGGGGTAAAAA
CCAGAGGCTTCTGATTTATCTTTTTCATACACTAATTTTAATGTTAATAAAGAAGGTTAA
AATTTGTATGATCTTCTAAATAACGACGAGACTTATCAAAAAGAGTCAAAAATTAATTAC
TTTAAGAACTCAGGTAAAATTCCTTCCTATTAGGACACAATGTAGGAAGGTGAAATAATT
AAAAAAAGGCTTAATGAAATGGCTGATTTTGACAATTGCAATGTGTCTAACAACGACAGC
GAAAAAAAAATATTAGAATCAGTTTAATAGATAAAAATAAATTCTATATCTCAACCTGTT
ACTTATAGATCAGTTAATACAACAACCCCTCTTTAAGCAAGATAAATTGAAAGATAGTAG
AATTCTATAGATTCTTAAAAAATGAATAGAAGATTTAGCAATTAAAATTATACATATAAT
ATTGAAGATAATTTCTAAATAAAAGAAAACACACAAGACCCAACAAAAATTTAAAGTATT
TCTGACTATCTGAAAAATGTAGCAGAAAATAACCAAGAAAGCTATTTAAATCAAAAAATA
GATTCATGTGATTTTAGATATAACAAAAATGGTAGAAATCTCATTCCATATAATCCCAAC
CAATATGGTAAAGATTTTATTAGGTAGGGTTGTGAAACATCGCAATCTGATTATTCAATA
CAATAGTATGAAGCCAAAAAGAGGTCAAGCTCTCTAACTACTCCTAATACAATAGTTTCC
GTTTCCAAATCAAGTGCTAATTGCTATGATAAAAGATTAGAAATTTCACCAGAAAGAGTA
ACTCTTTCAATAGATAAAGGATTAAACTCAAGTAACATTTAATGTGCATTAAATCAGTAG
ATAAATAAAAATAATGAAAACATAATAAAACTTTAAAACCTTTATGAAGACAGATTGAAG
AGAAGCGATACAAATATTTTAGAATAAGAAGATTCATCAAAGAGCGAGGATATTTAGAAA
AAATAACCATAATAGCCTAAAAAATAACAGTTAAATGACTAAAAATAATAAAATAATTCT
AATTAATGTTAATAATTACTATCTTAGTCCTCCTTAACATAAAATAATACTCAACCTATG
AAATTTATAAAGGTACTTGGAGTGCCTCATTCCAATAAAAGTGATCAAGTTGGAATTTTT
TTGAAGATGAAAGAAGAAGCTATAAAATAGAAAGAATTGCAAACAAATTCAATATTAGAA
TAATAAAATTCCATTTAAAAAATTTAAGAGATCACTCCATAGATTGCTCGTAATGCTAAC
AAAATAGCTTCTTAAAATTCTCTTGGGGTATCTATTTTGGAATAGTACATGAATCCAGAG
AGTTGTGCTATCAAAAAAAGTGATAAAAATAGTTAGAAATAAAACAAATCTTATCAGTTT
TAAGCTAATTAAAATGGCAATAATAACTTAGAAAATATAAATAAATAAAATCAAATAAAT
AATGGTTATTATTTACCTTAAGAAAAAAACGATTAAAAACCAATATCACCAGGTAATTAA
AATTAATCTAGCATGCTAAGTAATAATCCATATAATCAAATACAAAATGAATTTGAGCAG
AACTTATAATAAATACCTAAACAATAGCTTGATATATTGTAAGAATAAAAAATAAAATTA
AACAGCATACTTTATTCTAGAAAGTAATCATATAATAATAATTAAAATTTATAAGATTTA
CCATCAGCTAGACTTTCTGGATATTCAGTTGGAATTACAAGTTAATATGACAACAAAAAT
ATATTTAACTAAAATAGTAATTTAAATACCTTACCTATTAATGTTAGAACCCAATCAACT
GATAATTCACCTTATAACATATCAAAAACCAATCCTAATGAAATAGATGACTTAGAATTT
AAAACAAAATCTATGGTGAGATTTAATTTAAACTCAGACACTCCTCAAAGACATTCTTCA
TTCAATTATAGAAGGTAATAAACACCAGAAAAATCATCTCTCAAAGGAAGTAACAAATCA
CATCTAAATAGCAACTTAAGTTGCACTTCAAACGAAAGTGATTAGAAGGTAAGTAAAAGA
CTATCAACTTCTATAGATTTATCTAATAGTAAATATCACTATAATGAAAACCCAGTAAAT
TTATTTTATATGAACACACTTTAAAAAACCTAAAACCAGTGGTTGGATTTATATTCTGTG
AACCCATAGATATTAGCCAATGCATCTCCTTAAAAATATTAAAAAAGCAGATAGATTTAA
AACAACCAATAAATTCAACAATAGTGTCTTCCTCAAATAGCATGATTGTTTGTATTTATC
TTATTCAAATCAAAAATTTAGAAGGATATTTTATGTTTTTTTAATTGTTTTATTAATATA
AAAAATTTTCGAAATTTAAAGAGTCAA