Identifiers and Description

Gene Model Identifier

TTHERM_00637130

Standard Name

MRNO01 (Membrane Occupation and Recognition Nexus protein other)

Aliases

PreTt19716 | 91.m00131

Description

Protein with predicted MORN domains localized throughout the protein and/or associated with other domains having a predicted function. Protein kinase domain containing protein.

Genome Browser (Macronucleus)

GBrowse

Genome Browser (Micronucleus)

GBrowse

Gene Ontology Annotations

Molecular Function

Biological Process

Domains

Gene Expression Profile

  • Tetrahymena Functional Genomics Database:

Change in Gene Expression

TMHMM

TMHMM

Signal Peptide

Signal Peptide Present?: No
Presense Probability: 10.1%

TetraMine Data

TTHERM_00637130

WebApollo

Fullscreen View

Tetrahymena Stock Center

No Data fetched for StockID

Homologs (v.2006 protein sequences)

SourceIdentifierScoreDescription
Tetrahymena borealisEI9_40855.13.9991157591502974e-89hypothetical protein (343 aa)
OxytrichaContig12436.0.g453.99801309251602e-27Protein kinase domain
WormBaseWBGene000201423.9989916100764785e-24locus:aak-2 5-AMP-activated
protein kinase catalytic subun
it alpha-2 status:Confirmed
UniProt:Q95ZQ4 protein_id:
CCD68834.1
SGDYDR507C1.0004572433669413e-23GIN4 Protein kinase involved i
n bud growth and assembly of t
he septin ring, proposed to ha
ve kinase-dependent and kinase
-independent activities; under
goes autophosphorylation; simi
lar to Kcc4p and Hsl1p
DictyBaseDDB_G02691522.000620012690291e-23mekA on chromosome: 1 position
4015409 to 4017699
Stentor CoeruleusSteCoe_245750.000000000005109089028063325

General Information

No Data fetched for General Information

Associated Literature

  1. Ref:16933976: Eisen JA, Coyne RS, Wu M, Wu D, Thiagarajan M, Wortman JR, Badger JH, Ren Q, Amedeo P, Jones KM, Tallon LJ, Delcher AL, Salzberg SL, Silva JC, Haas BJ, Majoros WH, Farzad M, Carlton JM, Smith RK, Garg J, Pearlman RE, Karrer KM, Sun L, Manning G, Elde NC, Turkewitz AP, Asai DJ, Wilkes DE, Wang Y, Cai H, Collins K, Stewart BA, Lee SR, Wilamowska K, Weinberg Z, Ruzzo WL, Wloga D, Gaertig J, Frankel J, Tsao CC, Gorovsky MA, Keeling PJ, Waller RF, Patron NJ, Cherry JM, Stover NA,

Sequences

>TTHERM_00637130(coding)
ATGTAAAGCAAAAAAGATTAGAAGATAAGCGAATAGGAAATCAAAGATTTTTTGCAAAGC
AAAAAAAGTTAAATAACTTCTAGCTAAATTTTGCAGTCTATAAACTTTCTATCATAATAT
GGCTACCATGTAGTTTAATTGATAGATTCTGGGAGTTTCGGTGTTATTATGAAAGCTTTT
GATTCTTAGAATAACAAAAAATTTGTAGCAATAAAGCTAATCATAGTAACAAATATTGAC
ATTTTAAAAGATAATATTTAAGAATATTAGAAATGCCTTTTAATTAATCACCCGAACGTC
GTCAAAAATTATTAGCAGCTTTATGACTAAGAGAATGAATGCTAATTTATCATTACAGAG
TTTTGTTAAAAAGGTAATCTGTTTAACTTTTTTAAGCAAAATAATATTAAAAAAGAAGAA
ATTATTGAAATTTGCTCTTAAATAATTGAAGGTCTTATAGCTATTCATGATAAAAATATT
GTACACAGCGACTTAAAGCCTTAAAATATTCTTATTAATAATGATGATAAAATAAAAATA
TGCGATTTAGGAATGTCTAAATAACTATTAGGATCCTAATCTCAGACCATTTCAAAAGGT
GGAAGTTTAGATTATATGTCCCCAGAATAAATTGAAGGTAAGATTAGTAAATAATCTGAC
ATTTACTCAGTTGGATGTATTATTTGCTTCCTTTGTAATATTAACATATTTGGTTTGAAT
TTGGTTAATATAAAGAAAGGGATATTTCCTTCTATATAAGAAACCTCCTATAAAGAATTA
GTTAATTTAGCTTTTCAAATGATGAGTGTAGAGCCTAAAAATAGAATTTAGCTTCAAGAT
TGCTTAGATTAGTTGAAATTAATTAAGAAGAGTAACTCAGATAATCAAAAACGAAAACAA
GAAATTATTGTAAAGTAATTTTAAAATGGTGATAGATACGAAGGTGAAATGAAAAATGGA
AAGATGAATGGAAAAGGAATTTACTATTATAGAGAGCAAGATTCAAAAAAAAAATATGAA
GGTGAGTGA


>TTHERM_00637130(protein)
MQSKKDQKISEQEIKDFLQSKKSQITSSQILQSINFLSQYGYHVVQLIDSGSFGVIMKAF
DSQNNKKFVAIKLIIVTNIDILKDNIQEYQKCLLINHPNVVKNYQQLYDQENECQFIITE
FCQKGNLFNFFKQNNIKKEEIIEICSQIIEGLIAIHDKNIVHSDLKPQNILINNDDKIKI
CDLGMSKQLLGSQSQTISKGGSLDYMSPEQIEGKISKQSDIYSVGCIICFLCNINIFGLN
LVNIKKGIFPSIQETSYKELVNLAFQMMSVEPKNRIQLQDCLDQLKLIKKSNSDNQKRKQ
EIIVKQFQNGDRYEGEMKNGKMNGKGIYYYREQDSKKKYEGE


>TTHERM_00637130(gene)
ATGTAAAGCAAAAAAGATTAGAAGATAAGCGAATAGGAAATCAAAGATTTTTTGCAAAGC
AAAAAAAGTTAAATAACTTCTAGCTAAATTTTGCAGTCTATAAACTTTCTATCATAATAT
GGCTACCATGTAGTTTAATTGATAGATTCTGGGAGTTTCGGTGTTATTATGAAAGCTTTT
GATTCTTAGAATAACAAAAAATTTGTAGCAATAAAGCTAATCATAGTAACAAATATTGAC
ATTTTAAAAGATAATATTTAAGAATATTAGAAATGCCTTTTAATTAATCACCCGAACGTC
GTCAAAAATTATTAGCAGCTTTATGACTAAGAGAATGAATGCTAATTTATCATTACAGAG
TTTTGTTAAAAAGGTAATCTGTTTAACTTTTTTAAGCAAAATAATATTAAAAAAGAAGAA
ATTATTGAAATTTGCTCTTAAATAATTGAAGGTCTTATAGCTATTCATGATAAAAATATT
GTACACAGCGACTTAAAGCCTTAAAATATTCTTATTAATAATGATGATAAAATAAAAATA
TGCGATTTAGGAATGTCTAAATAACTATTAGGATCCTAATCTCAGACCATTTCAAAAGGT
GGAAGTTTAGATTATATGTCCCCAGAATAAATTGAAGGTAAGATTAGTAAATAATCTGAC
ATTTACTCAGTTGGATGTATTATTTGCTTCCTTTGTAATATTAACATATTTGGTTTGAAT
TTGGTTAATATAAAGAAAGGGATATTTCCTTCTATATAAGAAACCTCCTATAAAGAATTA
GTTAATTTAGCTTTTCAAATGATGAGTGTAGAGCCTAAAAATAGAATTTAGCTTCAAGAT
TGCTTAGATTAGTTGAAATTAATTAAGAAGAGTAACTCAGATAATCAAAAACGAAAACAA
GAAATTATTGTAAAGTAATTTTAAAATGGTGATAGATACGAAGGTGAAATGAAAAATGGA
AAGATGAATGGAAAAGGAATTTACTATTATAGAGAGCAAGATTCAAAAAAAAAATATGAA
GGTGAGTGA