Identifiers and Description

Gene Model Identifier

TTHERM_00080020

Standard Name

MRNN14 (Membrane Occupation and Recognition Nexus protein N-terminal)

Aliases

PreTt10247 | 5.m00598 | 3828.m01508

Description

protein with predicted MORN domains localized at the N-terminus of the protein

Genome Browser (Macronucleus)

GBrowse

Genome Browser (Micronucleus)

GBrowse

Gene Ontology Annotations

No Data fetched for Gene Ontology Annotations

Domains

Gene Expression Profile

  • Tetrahymena Functional Genomics Database:

TetraMine Data

TTHERM_00080020

WebApollo

Fullscreen View

Tetrahymena Stock Center

No Data fetched for StockID

Homologs (v.2006 protein sequences)

SourceIdentifierScoreDescription
Tetrahymena borealisEI9_06950.19.997093137033517e-262hypothetical protein (869 aa)
OxytrichaContig21976.0.g731.0001366335892501e-125MORN repeat
Stentor CoeruleusSteCoe_167224.0795586671775603e-41
WormBaseWBGene000021790.000000000000006999063783600386locus:jph-1 status:Confirmed
UniProt:Q22667 protein_id
:CAA99924.2
DictyBaseDDB_G03494880.0000000000000700196834671948DDB_G0349488 on chromosome: 2
position 6912714 to 6914186

General Information

No Data fetched for General Information

Associated Literature

No Data fetched for Associated Literature

Sequences

>TTHERM_00080020(coding)
ATGGATTTTAGCATAGAAGAGCACCCGCAAAATTTAATTTTACCAATCGAGCTAACAAAA
ATTATTTATTCAGAGTATGATGCAGAGCTCACCATTTTGGATAAACCTGGACAGGTTTAT
GGAAAAGCTCTTCATGGCTAAGGTAAAATAAAATTCAAAAATGGAAATACATATGAAGGG
GAGTTAGATAACGGTATGCTGCATGGAAAAGGAAAATTTAGATGGGCTAATGGAGTTATT
TATGAAGGTTAATTTGAATATAATACAATTAAAGGAGTTGGCACTTACTAATGGCCAGAT
ACTTCTACTTACACAGGTTAGGTTTTAAATGGATTACGTCATGGATAAGGTACATTTGTT
TCGCCTGAAGGAGAAGCAGAGTATACTGGATCTTGGGTAGAAGGGCTAAGAAATGGTAGT
GGAACTATTAAGTTTAAATCAGGTGCTATTTTTGAAGGATAGTTTGTAAATGGATGTAAA
CATGGTCATGGAAGAATGACTTATCCTTCAGGAAATTATTATGAAGGAGAGTGGAAATAT
GACAAAAAAGATGGCTAAGGAACAATGATATGGTTGAATTCTAAAGAAAAGTATTATGGA
TAGTGGAAAAATAACTTATAAAATGGATTTGGTGTTCATATATGGCTCGAGTCAAAAGGA
GAGGGGAAGTTAATGAGAAATAGATACGAAGGTTAGTGGGTAGATGGATAGCGTCATGGC
TATGGTGTTTTCTATTATGCCAATGGCTCAAAATATGAAGGTGAGTGGCGCAACAATTTA
AAAGAAGGATATGCAATCTTTACAGAAGACAATGGAAACCTTATTTAAGGCCAATATAAA
GCTGATCGTTTAATAAAGCAAGAAAACAATTTAAAAACAGATCTGAAAGAATAACAATCA
TAGCATGAAAAAGATAAATAAAACCTTGGAGGAATAGATTCTCCTTCAAAGGGAAAAACA
GGAAAAGATGACAAAACAAAATAGCCTGCTGCAATCAAATAAAAGACACAAACAAAAATA
AACGATCCAAAGGAAGTAAACTCAAGTTAGCAAATGGTGAAAAAGAAAGAAATAGAAATG
AATCCATACATTTACTTAGTTGATTTCTTCGATATGACTTAAGGCATCGAAGAGGGAGTG
TTGTCAATTCATTAAAATATCCAAACTATGTTGTTGAGACATAACAGTGATTTGAGAAAT
TGGTATAAAATTTACTCAAACCATCATGAAAATACAATTGGCGAAGATGCTTTCTCTATG
GACATGTTGGCCTTTTGGAAAATGATGAAAGAAGCTAAAGTCACAGATTAAACTGTTACT
CTTGCATCAATAAATAGATTATTTTATTAAGGAGTTAAAAATAGATACACAATTAACTCT
TAAGAATAGTAAATTCAAAAGTAAATTGAAATAGCTAAAAAGCTAGGCAGACCTCTAACT
TAAGAAGAGTTAAGAGACATAGTACTCTTAGACTTAATTATAAGCAAGACTTCTACTGAG
GATAAATTAGATTATTCAAAATTGGGAGAGTAAGAAGAAAAGAGTACTTAAGATGAAAAC
CAACTTTATTTGTACTTAGTAGACATACATGATAGCAAGAGAGCTATTTTATATAGACAC
TTTGTTGAATTGATTGTAAGAATGAGCTACTTAAAATACGGAGATATACAAAATGTGCAT
AGATCATTAGAGAAATTTATCCAGACCAAAATAGCTCCTATATTTGAAAATAAAAAGCTG
CCAAGCAAGAGCTTCAATAACTTAGAAGATACTGAAACAGGAGCCCAAAAGAAAAAAGTT
TTATTAGAGACATATCAAGATATATATAAAAATATTTATAATAGTCTAGCTTAGGACAAT
AAGAATCCTAAATATGGTATGATTGATAAGACAATCAAGTTCAAGGACATACTTAAGTAC
TTACAAGATTGTGAGTTAGTTCAGAATGATTAGGAAAAGAAACTTTTAATGTAAATATTT
GAAAAAACTTTTGACCCAACAAGCACTGTTTAGTATGTTGATTAGATGTAAAAAGAGAAA
GAAAAGGAAGATAAAGAAAGAGAAAGAAAGGAATTAAAAGACAAGAAAAAGAAGGCAGTT
AAATAGTAAGAATAAAACAAATAATAATTATTAGCTTAGTAGCTTGCCCAATCTAATAAC
GAAAAATACGAAAAGCTTAAAGTTACTAGATAGGCCTTAATATATGAGACTGAAATGCTT
CTTTATGAAGTTGAAGAACTTATTTCAGTTTATCTTCTAAAAAAAGAAAAAGACCTCTCA
ACTTCAAAAGATGATAATGATTTAATAAAGAAATCTAAGAAATATTTCGATTAGCTCTCA
TCTAAATTAATTGCATCTAAAAAGACATTATTTGCCCCTTAACCTAAAAAATAAAGATTT
TGGCCTTACAGCATAAAAGATAAATTGTAATAAAGTTAAATAAATATTTTGGATTGTATT
AATTAAATTAATATTAATAAAATAGAAAAGAGTAATTAGCATTAGAAAGAGTAAGAAAGG
AGGAAGCAGATAAAGCTAAAAAATTAAGAGAAGAAGAAAAGAAAAGAGAGACAAGAGAAC
GTGCAAAAATGGGCTTAGAAGATTATGATATAAATTCTGATCTAGAATTCGCAAATTAAG
AAGACGAAGATGAATATGATGATTACTGAAAATTTTTGTTTGATTTTATTATAAATGTAA
TAGTTAAAATTATTTGTTTGTTTATAAATGTGTAAATATTTTAGTGTATTTATTTATTTA
TAGTATTCCTTCCTACACAAATATCTCAATTCAAAAACAAAATTCCACTTTTATACCAAA
ATAAACATTTTTATATTTTAAAGAACTTTTTTTAAAAGAATTTTATAAGAAGGTTAATTT
AAATTTTTAATAACTTAATAGTTCAATTCATATTTTAGAATTCTTATTTATTTACACTTA
TTTATGGGTTACCTACAAAAAATCTCAACTCTAAAGATATTTGACTTTTAATATATCAAT
TAAAGATGTTTTTATTTTTATATTTAGAAGAAATTTTTAAAAGAACTTTATCAGAAGATT
AAATTAAATTTTTGA


>TTHERM_00080020(protein)
MDFSIEEHPQNLILPIELTKIIYSEYDAELTILDKPGQVYGKALHGQGKIKFKNGNTYEG
ELDNGMLHGKGKFRWANGVIYEGQFEYNTIKGVGTYQWPDTSTYTGQVLNGLRHGQGTFV
SPEGEAEYTGSWVEGLRNGSGTIKFKSGAIFEGQFVNGCKHGHGRMTYPSGNYYEGEWKY
DKKDGQGTMIWLNSKEKYYGQWKNNLQNGFGVHIWLESKGEGKLMRNRYEGQWVDGQRHG
YGVFYYANGSKYEGEWRNNLKEGYAIFTEDNGNLIQGQYKADRLIKQENNLKTDLKEQQS
QHEKDKQNLGGIDSPSKGKTGKDDKTKQPAAIKQKTQTKINDPKEVNSSQQMVKKKEIEM
NPYIYLVDFFDMTQGIEEGVLSIHQNIQTMLLRHNSDLRNWYKIYSNHHENTIGEDAFSM
DMLAFWKMMKEAKVTDQTVTLASINRLFYQGVKNRYTINSQEQQIQKQIEIAKKLGRPLT
QEELRDIVLLDLIISKTSTEDKLDYSKLGEQEEKSTQDENQLYLYLVDIHDSKRAILYRH
FVELIVRMSYLKYGDIQNVHRSLEKFIQTKIAPIFENKKLPSKSFNNLEDTETGAQKKKV
LLETYQDIYKNIYNSLAQDNKNPKYGMIDKTIKFKDILKYLQDCELVQNDQEKKLLMQIF
EKTFDPTSTVQYVDQMQKEKEKEDKERERKELKDKKKKAVKQQEQNKQQLLAQQLAQSNN
EKYEKLKVTRQALIYETEMLLYEVEELISVYLLKKEKDLSTSKDDNDLIKKSKKYFDQLS
SKLIASKKTLFAPQPKKQRFWPYSIKDKLQQSQINILDCINQININKIEKSNQHQKEQER
RKQIKLKNQEKKKRKERQENVQKWAQKIMIQILIQNSQIKKTKMNMMITENFCLILLQMQ
QLKLFVCLQMCKYFSVFIYLQYSFLHKYLNSKTKFHFYTKINIFIFQRTFFKRILQEGQF
KFLITQQFNSYFRILIYLHLFMGYLQKISTLKIFDFQYINQRCFYFYIQKKFLKELYQKI
KLNF


>TTHERM_00080020(gene)
ATGGATTTTAGCATAGAAGAGCACCCGCAAAATTTAATTTTACCAATCGAGCTAACAAAA
ATTATTTATTCAGAGTATGATGCAGAGCTCACCATTTTGGATAAACCTGGACAGGTTAAA
AAATATTTCAAATGTTATTGTTTTAATAAATTTGGCAATAAATTCTAAATGACTAATATA
GATATTGATTGATTGATAGATACATTAATTTGCGTTTTTAAAATTAGGTTTATGGAAAAG
CTCTTCATGGCTAAGGTAAAATAAAATTCAAAAATGGAAATACATATGAAGGGGAGTTAG
ATAACGGTATGCTGCATGGTAATAGGATTTGATTTAATTTATTTAAACCTTTTTAGCTTA
ATCAATTTAATATAACTATTTAGAAGACATTTATTTAGTTTTTTTAAAAATAAACACATT
TTGTTTTTTTAGGAAAAGGAAAATTTAGATGGGCTAATGGAGTTATTTATGAAGGTTAAT
TTGAATATAATACAATTAAAGGAGTTGGCACTTACTAATGGCCAGATACTTCTACTTACA
CAGGTTAGGTTTTAAATGGATTACGTCATGGATAAGGTACATTTGTTTCGCCTGAAGGAG
AAGCAGAGTATACTGGATCTTGGGTAGAAGGGCTAAGAAATGGTAGTGGAACTATTAAGT
TTAAATCAGGGTAAATTAACATAGATTATTAATAAATGTAAATGCGACAATTAAAAATTA
AATAAACTTTTGTATGGAAAATTAGTGCTATTTTTGAAGGATAGTTTGTAAATGGATGTA
AACATGGTCATGGAAGAATGACTTATCCTTCAGGAAATTATTATGAAGGAGAGTGGAAAT
ATGACAAAAAAGATGGGTATTAATTATTTTAGAATTAAAAGCTAAAAAGTTAAAAAATAA
ATTGTTTATTAATTATAGCTAAGGAACAATGATATGGTTGAATTCTAAAGAAAAGTATTA
TGGATAGTGGAAAAATAACTTATAAAATGGATTTGGTGTTCATATATGGCTCGAGTCAAA
AGGAGAGGGGAAGTTAATGAGAAATAGATACGAAGGTTAGTGGGTAGATGGATAGCGTCA
TGGCTATGGTGTTTTCTATTATGCCAATGGCTCAAAATATGAAGGTGAGTGGCGCAACAA
TTTAAAAGAAGGATATGCAATCTTTACAGAAGACAATGGAAACCTTATTTAAGGCCAATA
TAAAGCTGATCGTTTAATAAAGCAAGAAAACAATTTAAAAACAGATCTGAAAGAATAACA
ATCATAGCATGAAAAAGATAAATAAAACCTTGGAGGAATAGTATGAAAATTGATAAATGT
ATAAATATTGATTTAATTTCATTTTAATTTATATGGAATAGGATTCTCCTTCAAAGGGAA
AAACAGGAAAAGATGACAAAACAAAATAGCCTGCTGCAATCAAATAAAAGACACAAACAA
AAATAAACGATCCAAAGGAAGTAAACTCAAGTTAGCAAATGGTGAAAAAGAAAGAAATAG
AAATGAATCCATACATTTACTTAGTTGATTTCTTCGATATGACTTAAGGCATCGAAGAGG
GAGTGTTGTCAATTCATTAAAATATCCAAACTATGTTGTTGAGACATAACAGTGATTTGA
GAAATTGGTATAAAATTTACTCAAACCATCATGAAAATACAATTGGTAAATTAAACATAC
ATTTTAAAATTGAAAATACTATTTTATTTAAATAAATAAATAAATAAATAAATAAAGGCG
AAGATGCTTTCTCTATGGACATGTTGGCCTTTTGGAAAATGATGAAAGAAGCTAAAGTCA
CAGATTAAACTGTTACTCTTGCATCAATAAATAGATTATTTTATTAAGGAGTTAAAAATA
GATACACAATTAACTCTTAAGAATAGTAAATTCAAAAGTAAATTGAAATAGCTAAAAAGC
TAGGCAGACCTCTAACTTAAGAAGAGTTAAGAGACATAGTACTCTTAGACTTAATTATAA
GCAAGACTTCTACTGAGGATAAATTAGATTATTCAAAGTATAACTAAATAAATTACAAAA
AAGATGTTTAAAATTAAAATTATATTACTAATTTAGATTGGGAGAGTAAGAAGAAAAGAG
TACTTAAGATGAAAACCAACTTTATTTGTACTTAGTAGACATACATGATAGCAAGAGAGC
TATTTTATATAGACACTTTGTTGAATTGATTGTAAGAATGAGCTACTTAAAATACGGAGA
TATACAAAATGTGCATAGATCATTAGAGAAATTTATCCAGACCAAAATAGCTCCTATATT
TGAAAATAAAAAGCTGCCAAGCAAGAGCTTCAATAACTTAGAAGATACTGAAGTAAATAT
TAATAGTAGATTCTTTTTTTAAGAATTAATTTTAATTTTTTTAAATTTAGACAGGAGCCC
AAAAGAAAAAAGTTTTATTAGAGACATATCAAGATATATATAAAAATATTTATAATAGTC
TAGCTTAGGACAATAAGAATCCTAAATATGGTATGATTGATAAGACAATCAAGTTCAAGG
ACATACTTAAGTACTTACAAGTAAGATAAAATTTAATTAGTTTGAGGATTAGGATATATA
AATTTTATTTATTTTAATAGGATTGTGAGTTAGTTCAGAATGATTAGGAAAAGAAACTTT
TAATGTAAATATTTGAAAAAACTTTTGACCCAACAAGCACTGTTTAGTATGTTGATTAGA
TGTAAAAAGAGAAAGAAAAGGAAGATAAAGAAAGAGAAAGAAAGGAATTAAAAGACAAGA
AAAAGAAGGCAGTTAAATAGTAAGAATAAAACAAATAATAATTATTAGCTTAGTAGCTTG
CCCAATCTAATAACGAAAAATACGAAAAGCTTAAAGTTACTAGATAGGCCTTAATATATG
AGACTGAAATGCTTCTTTATGAAGTTGAAGAACTTATTTCAGTTTATCTTCTAAAAAAAG
TAATTCATAAATTGCAATCAGAAATAATATTAACTTGATGGCTTATATTAACAGGAAAAA
GACCTCTCAACTTCAAAAGATGATAATGATTTAATAAAGAAATCTAAGAAATATTTCGAT
TAGCTCTCATCTAAATTAATTGCATCTAAAAAGACATTATTTGCCCCTTAACCTAAAAAA
TAAAGATTTTGGCCTTACAGCATAAAAGATAAATTGTAATAAAGTTAAATAAATATTTTG
GATTGTATTAATTAAATTAATATTAATAAAATAGAAAAGAGTAATTAGCATTAGAAAGAG
TAAGAAAGGAGGAAGCAGATAAAGCTAAAAAATTAAGAGAAGAAGAAAAGAAAAGAGAGT
AATTTATTCATATAATTATAAATATCTTTTATTTTTTATGATTTTGTGGATAAAATCAAT
TAATTTCAAATAAAGGACAAGAGAACGTGCAAAAATGGGCTTAGAAGATTATGATATAAA
TTCTGATCTAGAATTCGCAAATTAAGAAGACGAAGATGAATATGATGATTACTGAAAATT
TTTGTTTGATTTTATTATAAATGTAATAGTTAAAATTATTTGTTTGTTTATAAATGTGTA
AATATTTTAGTGTATTTATTTATTTATAGTATTCCTTCCTACACAAATATCTCAATTCAA
AAACAAAATTCCACTTTTATACCAAAATAAACATTTTTATATTTTAAAGAACTTTTTTTA
AAAGAATTTTATAAGAAGGTTAATTTAAATTTTTAATAACTTAATAGTTCAATTCATATT
TTAGAATTCTTATTTATTTACACTTATTTATGGGTTACCTACAAAAAATCTCAACTCTAA
AGATATTTGACTTTTAATATATCAATTAAAGATGTTTTTATTTTTATATTTAGAAGAAAT
TTTTAAAAGAACTTTATCAGAAGATTAAATTAAATTTTTGA