Identifiers and Description

Gene Model Identifier

TTHERM_00703320

Standard Name

MRNN10 (Membrane Occupation and Recognition Nexus protein N-terminal)

Aliases

PreTt20108 | 110.m00081

Description

protein with predicted MORN domains localized at the N-terminus of the protein

Genome Browser (Macronucleus)

GBrowse

Genome Browser (Micronucleus)

GBrowse

Gene Ontology Annotations

Cellular Component

Molecular Function

Biological Process

  • nucleobase-containing compound metabolic process (IEA) | GO:0006139

Domains

Gene Expression Profile

  • Tetrahymena Functional Genomics Database:

Change in Gene Expression

TMHMM

TMHMM

Signal Peptide

Signal Peptide Present?: No
Presense Probability: 9.9%

TetraMine Data

TTHERM_00703320

WebApollo

Fullscreen View

Tetrahymena Stock Center

No Data fetched for StockID

Homologs (v.2006 protein sequences)

SourceIdentifierScoreDescription
Tetrahymena borealisEI9_15322.19.997093137033517e-262hypothetical protein (3409 aa)
Stentor CoeruleusSteCoe_231986.305116760146989e-16
OxytrichaContig17235.0.g460.00000000007999955850159168GCC2 and GCC3
DictyBaseDDB_G02788250.00020003864201578029DDB_G0278825 on chromosome: 3
position 1248051 to 1250768

General Information

No Data fetched for General Information

Associated Literature

No Data fetched for Associated Literature

Sequences

>TTHERM_00703320(coding)
ATGAAAGAATAAGAAAGTGGGAATTTAGAAAAAAGAATCAAGCTCATTGAATATAGAAAT
GGTATATACTAAGGTATGATACACCCTAATGAGGATAGAACTAATTTAGGTATATACACA
TGGGATAGTGGTGAAGTTTATTTTGGAGAATGGAAGCATGATATGTTAGATGGAGAAGGT
ATTCTCTTCTTTCCATTTGGAGGTTTTATCCATGGATTCTTTATGAAAAATAAGCTAAAT
GGAGCTGCATTTTTCAAATTTTCAAATGGAGATATTTATGAAGGCTTCTGGAGAAATGGT
AAATTAGAAGGCAATTGTTACAAATATTTTTGTGACGAAGAGAGATGGATTCTCTCTGAT
TATAAGAATGGCGAATTCAAAAAAATAATTTCAAAAGGCGATGGTCAACCTCCTTCATAT
GTATTTAACTACATAACTTCAACTTCAGATATAGCAGTTAAGCACCAAGACGACACATTC
TAATAAGATGGTCTTAAAATAGAAGCTATTAATTTTAACGATGGAGGATAGTATTTAGGA
TTAATTAAAAATAGCATGCCAACAAGTTTAGGTATCTTTAAATATTCTGATGGCAAATAC
GACGTTGGATACTATAAAGATGGCAGTCTTGATGGATTAGGAAGATTGAATTTGCATAAT
GGAGATGTTTTTGATGGATTTTTATAGAAAGGATTATTCAATGGTATTGGTGTTTTCTTT
TAAAAATAAAGCTGCTCATGGATATATGGAAACTTTGAAAACAATAAATGTGTCAATATT
CTTAAAAAAGGATAGGGAGCTTTTCCAATTGAAATAATAGAAAAATTCAGATCTGAGAAT
CATAGAAAAGCTAAAAAATATATTGACAAGATTACTCCTTTAGACGTTTATTTTGCTCCT
ATGTACAATCACATCCCAATAGGTCCTGAAAAGCATAATTTTTACTTAGATTTAAGTATT
ACTAACCAAGCAAATCTTTCTAATAATGGTGGATCTTAATAAAAAATACCTGAGTAATTA
CCTATGAAAAAGGTTTTGCCTAAAGATCTCACTTCATCTGACTACCAATCACCTCCTTAG
AAAAGAAGTTAATCAAAAGGTAAAACTTAGTAAGTTCCTTTGAAAACTCCTTCTGTTTCA
TCATCATTAGTGAGTTCAGCAAATAGATAAGATAACTAAAACCTCAAAAAAGATAGATAA
TCAAGCAAATCAATAGGTAAATCACAAACTATGCAAGCTTAGTAATAAAACCCTAAAATA
TTCGTCTCTTAATCATCATAGGGATAAGATTTAAAGTAGTCATAATAGCAATAACAAGAT
AAAAAGTCAAATTCTAAGAAAGAAGTTCCTAAAAAATAAAATTTAGTTTCTCCCCCTCCA
AGATAAGGTAGATTAGGTGCTCAGTAATAATAGTCAAATCAATCTTCAGCCAAAAAAAGC
AACTTAAAAAAAGCTAAACAAAATTCCTCTAACTCTAACAAGCAAAGGTCCAGATAGTCA
TCTGTCTCAAAAATTTAAAACGAGAAATAAGAGATAGATTAACAAAGTATTCATGACTAT
GACAATATGGTGAAGTTAATGAGCTAGCATTAAGAAGGTTAAATTAATATATCATAATCT
TAAGGGTAGAATATAAATTTTGATGAAGTATTTAATACTGAAAGTAGCCCTAAATCATAG
TAGATTTAATAAAGAGAGTTTAAATAATAAAAGAGTTTAGCATAAATTATAGGTAGTGAA
GAGATTGATGAACCAAAATAGTTTCCCTACTAAAAATCTAAATCAATGGCAGTATTTAAT
TCTAAGAAATCATCCTAAGCTTCTTCTGTCAAGCAGTAAAACATTCATGAAATTGGAAAT
GTGTCTAAAATTTCAGGCATAGGATAAAGTGACACTTCAGGAGTTTACAAAGACAATAAT
AGAAGTGGAGTTGCTAATTAGGGTGATTTTACAGGGATTATTAAACCTAATATATTCGGC
AAAAAGTCTTCAAGTGCTCCTAAATAAGCTAAATAAGTCTAAAATAAGCAAAAAGATGAT
AAATCAGGAACAAACAATGAGCAAAGCGATTCTGACTCAAGCTTTAGTTCATATAGCAGT
GATAGAGTTGTTAGAAAATAGACAGCTCCTCCTACATCTGGTAGAAAATAGATTGCTATA
ATAAAGGAAGAAGAGAGAATGAGATCATACTCTGGTACTCCTGCAAATAGATTTGTTGAA
AGCTATACAAATAGAGATTATTTTGGCTCTAGAGATGATCAAGTTAGTTCTGGAGGTAAA
TCGTATAAAAATGAATAGGATTTAAGAGAGAGCTTGGAAGAAGAAGAAAATAAATAGTTT
TTGGAAGCAGAAAGATTGTCAAAAGAAGAAGTTGAGAGTAAAATTGAGAGAGCTCATGAT
AAGAAAAATAACGATTAAGATGAAGAATATGGGCATATAAAAATTAAAGATATAATAAAT
GTTGATGACTAGTCAAATTAAAATAGCCATGTAGGTGAGCAATCAAGAAAGGGTGCAGAT
TCAACACCACACAATTAGTTTATCACTATTCAAAATTAAAAAAATAAGCCTATTCAAATT
TAAAAAAATGAATAAATTATTTCTGATAAGCAAGGATTTAACCAAATTGAAAAAGATAAT
GACACTCCAATAAGCAAAAAATTAGAGGATTTATAACACCTAGCATAAAATAGAGACATT
CAAAAAATGTATTAATCAAAAAAGAGCAACTCAATTTTAGAATTAGAAAATATCCGAAAC
GAAATAGCCAACTATGAGCAAATAGCATAATAAGATTTACCATAAAGAAGCAAAAAATCA
AAGTAAGGGAAAAAAGACACATCTAGAGAAACTTCACATCCTCGTACTCCATAATCTATA
GTTACTCCTAAACATCTACCAAGCTAATCCCCAAACTTCTAATAAAGCCCCATTCTAACT
AGTCTACCTAATCCTAAAATATAATATTAATAAGAAGAGGAGCTAGATCTTGAAGAATCA
GAACATGTTTTAGACTCAATAAAGTAGATAAAGCAGTAAATGATTCATCAATTGAATCAT
TTAGAAAACAAGCAAAGAGAAGTTACCACTCCTGCAGCATCAAACTTTAAATATAATATA
GCCCCTAATTTTAATATTCCGAATGATGAAAACCACATCTTAAAAGATGATTCCTTAAAC
TAAGATATATCCCCTCAAAATCCTATCGAAAATTTTGAATCTCCTTTCAAAAAAGACAGT
CTAGTTTATGAAAGAGAAAATAGTCAGGGCAGAGGTAGAAGCACCAATCATAGCAGAGTA
GAAAACAGCAGAAGTTATAAATATTATACTGAGGAGGAGGCTAACCAGATAGCCTAAAAG
ATTGAACAAAATCTGGCATTCTAAGGAGATTAAACCAATAAACAAACAAAAGTAAGTGAA
AATGAGAGAGGAGAAAACTTTATAAATGAAGAAAGTGTGCAAGTTGGTGACATTAATGAG
GAGATTCAAATCGATGATCAAAGAGCCGGTCGTGAAGATAGAGTTGTAAGATCAAAGCTA
GAAAGAGATTCAGAAATGCATGATATTTAAGAGAAATAAATATAAGATTCTATTTTATAA
GCAGAAAAACTCAATTAAATGCTTGATGGCAACACAAATTAACAAAGATTAAACTAAATT
CAATCTTATCAGAGATAATAAAACGAATAAATGAGACTTAGCGCATAAGGATAGTAAGAA
TTTTTAGCATCTTAGAAAATAGATGAGTAAAACTAAAATCAAAAAACTCAAGCAGCATAA
ATTAATTAATAAAATTAATAAGGTTAATCTTAATAAAACATAAAAAACCATTCAGTAGCT
GCATCACCAAATAGTCAATCTCCAATAAATTAAATTCAACAAAGATCAATCAGCCCCCAA
AGTAATTCCTTGAATTCAAGTCAAATTACAGCTGGCTAAGTTATTTAAGTTGTCAAAGAA
ATACTCCCCCCAACTTAACAAACTACTATTTATTAGAAAAAGCTAAGTGATAATGCAATT
TAATCTACTGTTGTTACTAAAACAATACAGCCAATCGTCACAACCAAAATTATTTCACCC
GTTCGTTCTCGTCCGTCAAGCTAATCTAACTCTCCTTTAACTAAATAAAATTAAAATGCC
CTATAAAATAACAGCCCTGGCAAATTTAATAGCCAGATTATTTCACAGTAATTACTACCC
TAACAAGTACTAGGATAATTACAGTCTATAATAGGAGGAGGAAATTCTAATCAGTAAGGT
TAACAACCTGCAAATTAAAATAAAATTTATTCTGATAGGACCCAAAATAGAATAGTGTAA
GCCGTTAATTAATAATGGAAGCAAAAAAATCCTGAATTATTCTAAAATATAACACCAATG
GAGTTTTATTAGAGTATTGTTCAAAGATAAAATATACTAAAGGACTTAAGTCCTGAACAA
CTTGAATAGCTTGAATAAGACATAAAAACTTTGAAGCAGATGAACGTAGCTGATGACCTT
TAGATAATTCTAGAATAAAACATCTCTAATGTTACTTCACCTTTGAATGCATCTAATAAC
ACAGATATTAAACATTACACATTTTAAGGAGATGATATTACTCCCTCTTTGCAAAGAAGA
AAATAAGAAGAAGAATTAGCAGCTACTGCTGCAAAAACTGCATTAGATGTTACCGCAGCT
GCTGAAAAGGCTAGAAAGGAGTATGAAATCTAGCAGCAACATCTGCAAAATCAATTAGCT
TTAACTCAAAATCACACACTCTTAACTTAATAATAATAGAAAGAAATATAAGAACTTAAA
AAGTAGTAAGAAGAATTTATTAAGCAACAACTTGAAATACAAAAATAATAGGCTGAGTAT
TTAGAAAAGCTTTAAAAGTAGCAAGCATTAATCATTTAATAAGGAGAAGAATAGCGTAAA
CGCCATGAAGAAGAAAAGACTCGCTAGCTTAAGGAAATAGAGGCTCTTGAGAAATAAAAA
AACTAAAGAATCATAGAAGAAGAAGAGAGATTGAAGTAACTACGTGATATGCAAGAAATG
GTGCGCCAATAGATAGAAGATGATTTACAACGCAAAAAATTAGAAGATGAAGAGCACAGA
AAGCGCTAGAAAGCTCTCTTTGATAAAGAATAAGAAATTCTAGATAGATTGCAAGATGAA
TAGGTAAAACTGTCTTAGCTTTAATAAGAATAGGCCAGGCTTTAGGCTTAAGAGTTAGAA
AATAAAAAAGTAAGAGATATGTAATTAAAAATGGAAGAAGAGCTAAGAAAGAAGGAGGAA
GAAAAATTGGAATAATTAAAGATATAGTCTGCTTCGCTAAATGAAGAGATAAAGAATAAC
CAAAGCAGGAGTGAAGAAGAAAGAGTAAAAATGCATTAACTGTAGTTAAAATATGCAGAA
GATCAAAGAAAATAATAGGAAATCTTAGATGAATTAAATTCATAAAAATTACTTAAAGAA
AATTCACAACGTTAACAAGATATTATTTAATAATAAGACATACTTGAATAGTAGAAATAA
ATTAATGAGTAACAATATGCTTTGTAGCAGGAATAGCTTAGAATTCAACGTGAGCGTGAA
GAGTTAGAGATTTTACAAAAATAGAGAAACGAAGAATCTTTCATTAACGAATAGTAAAGA
CTTGCTATTTTACAATCAAAGGAATAGGAACTAGAATAATAGATTCGCTAATAAAATTAG
TCTTTCTTAGCCTAATAAGAAGAATTATAACGCTAAAAGTAATAACTAGAGAGTTAAAAG
CTCGATCTCATTTTAGAATAAGACCGTTTAAAGAAGAAGTCAGATCTCGATGATGCAAAG
TTGAAGGATGTTGAAAAAAATCTATAGGAGTAATTGAGTAAAATAGAGAATGAAAAAGAC
TAGTAAATATAAAGAGATTAAGAAATATAAGCAAGAGTGAGACAAGAATCTATAAATGCA
CAATAGGAAGAGCTTCAGCGTTAAAAATAATAAATTGAATTCTAAAAATAAGATCTGATT
ATAGAGTAAGAGCGCCTCCGTTAAAAATTAAAAGAAGAAGAAGAAAAGAGATTAGAAGCT
GAGCGTATTTTATAGGAAACGATTTTGAAGAAGTAGTTAGAAGATTCAGCAACTGTTTAA
TTAAAAAATTAAGTTGATTTAGAAAAATTAGAATAATAGAAGTAAATTGAAATTAAACTT
CGTGAGCAGTAAGAGTAAATTAAGAGAGAGAAAGAACAATTAGAGAGAGAGCGCTAGTAA
TAGGAATATGAAAAGCAAAAGCAGCATGAAAAGGAGAAAGAGGTTATTGAGTTACAGAAT
GCCTTGAAGTAAAAGTAACTATTTTTAGAATAGTAACAGCGAGAAACACAACTTAAATTA
GAATAGCAGTTTAAAGAATAGCAAGAATAGATGCTTAGAGAAAAAACCGAAATAGAAAAA
TAAAAAATAATTCAGGAACAATAAAAATAAAAGCAAATTGAACTTGAACAAGCAGCAAAA
TAATAAGAAGAACGTTTAAAATAGTAAAAACTATTATTAGAACTAGAACAAGAATAAAAA
AAAAGAGATGCTGAATAACAGCTTCGTTTCCAACAAGAGCAAATACAAAAAGAAAAAGAA
GAAGTCTAAAAGTAAAAAGAACTTCTTGCTTAAATGGAAAGAGAGAAAATTGCTATGGAG
TTAGCTCGCTAGCAAAAAGAACAAGAAGAGCGTAGAAAGATAGAAGAATAAGAAAAAAGA
GATAATTATTTTAAAAAAGTAGATGTATTCACTAAGGAAATAGAATCTAGAAGAGGTTAC
ATATCACCTCGTTAATCTTCTCTTGATATTCCTCCTTCAACATAAGTAATCTTAAATAAT
CCCAGCACTTTAGAAAATAAAGATAGTTCTAATCTTCTTTTCAAGACAAACCAAAGCGCA
AGCAGTTCACCTATTAATACAAATCGCTCAGATATCGAAACTATGATTAGGGAATCCCAA
GCTCGCTTAAAGCAATCAATAGCCTAATCTGTCTAGTAAGTTGATAAGATAGGATAAATT
GTAAATCCTTATTAAGATATTTCAATTAAGAACTCAGAAAGTGCAGAGGCTGTGAAAAGA
TCGACACATTAACCAACCACTACATAATATCCTATAACAAATACTAATTTGTAATAAGAA
TCTCAGCCCTAAAAAGACATTCTTGAGAGTTACTCTCAGTAAAAAAATATCGATTTATTT
AACCAAATTGACAAAATAGTGCGTTCAGCTTCTCAATCTGCCTCCACTTCACCTATAGGC
ACTAACAACAATAAAAATAACTTTGGAGATTCTCTAGATAGACTTAACAGGTTCACTGGC
TCATAAGTTACTTAGTAAACTCCATCAACAGAAATAAAGAATTAGGCTTAGACTGATCTA
GATTTATAAAATAGAGTAAATCAAATATAGAACTAATCTAAATCTAGTGAATCAGTAATA
TCTGCGTTACCTACTCCAATAAATTCTGTATAACCAATATAAACAAAAACTACTCAAGAA
TAAAAGAATAGTAGCTACATACCAACATCAGATGATTTTAGAGGTAGTTTATTGTTAAAT
AACTTAGAAAAATCTACTCAAAACCAAATAAGAAGCGATCTATTTAAAAGCATTGAAGGG
GTAAATTCAATAGTCTCCCCTAATTCTAAAAACCAAAATAAATCAAGCTTTGGAGATTTT
AGTAGCTAGAACTAATAGCAAAATAAGGTTTAAGGTGTAAGTGACTACACATCCTACCAA
TACTAATCTTAAGTAAGCAGTACTCCAAGCAATCCTATTTTCCAAAAAATAGAACCTTCT
GCTTTGACTAATAATAACAGTGCTAATAAATAGCCTTTGGAGAAAAATAATTAATACTAA
TTACCATCTAGTGTTACATTTAGTGCTCTTCCTTCTGTTACTTCTTATATGCCATTAACC
CAAAGTATTTAATAAAATACTGTATAGGGTGAAGGATTACTCAATCGTTTAGATAACAAA
AACGATAATAAAAAACAGAATGCAAATTCTTAATAGAATCCAGTTAGTGAGCAAATAGTA
GACAGTATTTTGAGTGAACCTTTTGCTCCTTAGCCAACTGCTAATTTTGATACCCGCTCT
TCAATCAGCTCAATCAAAAGAGAGCCTATTAGTTACCCTGGAAACACATATACTGCATCA
GTTAGCGGAATTCCAATTTAACCCTATTCATCTTGGACTAATCCAGTAAGCTTGAACTCG
AGTGGAGGAACAGCTGCATTTTTGGGCTTACCAGTTTCATAGTAAAACAAAAACTCTCAG
CCATAAACTAATTAAAATAGTGCCAACTAAACCTTGTTTGTTTCTTTTGGTAATGAAAAG
ATTTTGGGAAGTAATCCATTAAAATCTTCAGTTCCTGGTACTAATAAGGATTAAATTTTG
TCAGGACTACCAACATACACACCATCAATATTGATGAGCACTTCTTTTAGTAAATTACCA
AACAATTCGTTCAACTAAGGAGAAAAAGATAAACAATCATCTGTAAGATCATCAGGAGCA
GTCTCTAACGAGTATAAGTAAGCCCTCTATTAAAAACAAAATATCATTCCAGCAAGCGAT
TAACTTACTGCTGGTGCCCTTAAAAGCAATCCTACTACTTATGTTTCTAATTAAAAACCT
TCAATAAATATTGGTAATATTAACCAAGGTTCTTACACTACTTCTTCTTTAACTGGAGTC
GATGCTTACATTCCACTTACTACTGGTGCTTCTGCTCTGATTTCGCCCAGAACTCAAGAA
TTAAATTCCTACAAGATCACCACTTCAGCCCTAGTCCCAAGTAGCAGATAAGTTGTAATT
GGTAATCCCAGTAGTATTGAAACTTCAGATTAGAAATATAATAAACGCTTATCAATAACG
AGTGATGTCATCGAAGAAGATCCAAAGCGCAGCAACAACTAAGATAGTGCTTCAAAGCTC
GGAAACAATACGCTAAATTCTTCTGCAGGCTTTATCGGTTACAAGAAAAAAATAAAAATA
CAGCCATCTCCATAGGTGATAAAGGAAACACATCTTCCTGTAATTCGCAGTAATTCCAAT
AATAATAGCAAAGATTCATCATTTTTCCTTAATAACAATTCTTTTTCATAAAATAATCCA
AAAATACCAAACCCTACTTCTGTAGCTGCAGGTAATAATAACTATATATTGAATAATTCT
TTCAGCAACTTAAATAACTCATTTTCTGGTGCACCTAAAGACACAATTACAGCTGGAACA
AATTTCAATAATTTTTTGAATAGCTCATTCACTGATGAGAAATCTAAATAACAAAGAAAT
ACTCTTGACAAACTTAATAAATAAGGCTAATTAAATTAGGTAAATGGTTTAATTAAGAGT
GGTGAATCATAATAATCATAATAAAAAATTTCTTAATTCAACTCTCCTTAATCTTAAAAG
ATAGCTAGCCAACTTGCCTCTACTTAGAATCTGAATCGTTTTGCATCACCTTAATCAGAT
ACTTCGAGAGGATCTGTTTCTTTAACAAAAAAAACTAATGTCACTGTGGTGCATACTCCA
GGAACAGAAGGTGCTATATCCTTAGTTAGAGCCATCTAAAATACTTACACTTATAACGAA
CCTACTCATAACGATGATAGTTTCCACAATAGCAGTTTTAACAATTTGAACAAATCACTT
CTCGATTCCCAGGCCTCACAATATTTGGTATACATTTGA


>TTHERM_00703320(protein)
MKEQESGNLEKRIKLIEYRNGIYQGMIHPNEDRTNLGIYTWDSGEVYFGEWKHDMLDGEG
ILFFPFGGFIHGFFMKNKLNGAAFFKFSNGDIYEGFWRNGKLEGNCYKYFCDEERWILSD
YKNGEFKKIISKGDGQPPSYVFNYITSTSDIAVKHQDDTFQQDGLKIEAINFNDGGQYLG
LIKNSMPTSLGIFKYSDGKYDVGYYKDGSLDGLGRLNLHNGDVFDGFLQKGLFNGIGVFF
QKQSCSWIYGNFENNKCVNILKKGQGAFPIEIIEKFRSENHRKAKKYIDKITPLDVYFAP
MYNHIPIGPEKHNFYLDLSITNQANLSNNGGSQQKIPEQLPMKKVLPKDLTSSDYQSPPQ
KRSQSKGKTQQVPLKTPSVSSSLVSSANRQDNQNLKKDRQSSKSIGKSQTMQAQQQNPKI
FVSQSSQGQDLKQSQQQQQDKKSNSKKEVPKKQNLVSPPPRQGRLGAQQQQSNQSSAKKS
NLKKAKQNSSNSNKQRSRQSSVSKIQNEKQEIDQQSIHDYDNMVKLMSQHQEGQINISQS
QGQNINFDEVFNTESSPKSQQIQQREFKQQKSLAQIIGSEEIDEPKQFPYQKSKSMAVFN
SKKSSQASSVKQQNIHEIGNVSKISGIGQSDTSGVYKDNNRSGVANQGDFTGIIKPNIFG
KKSSSAPKQAKQVQNKQKDDKSGTNNEQSDSDSSFSSYSSDRVVRKQTAPPTSGRKQIAI
IKEEERMRSYSGTPANRFVESYTNRDYFGSRDDQVSSGGKSYKNEQDLRESLEEEENKQF
LEAERLSKEEVESKIERAHDKKNNDQDEEYGHIKIKDIINVDDQSNQNSHVGEQSRKGAD
STPHNQFITIQNQKNKPIQIQKNEQIISDKQGFNQIEKDNDTPISKKLEDLQHLAQNRDI
QKMYQSKKSNSILELENIRNEIANYEQIAQQDLPQRSKKSKQGKKDTSRETSHPRTPQSI
VTPKHLPSQSPNFQQSPILTSLPNPKIQYQQEEELDLEESEHVLDSIKQIKQQMIHQLNH
LENKQREVTTPAASNFKYNIAPNFNIPNDENHILKDDSLNQDISPQNPIENFESPFKKDS
LVYERENSQGRGRSTNHSRVENSRSYKYYTEEEANQIAQKIEQNLAFQGDQTNKQTKVSE
NERGENFINEESVQVGDINEEIQIDDQRAGREDRVVRSKLERDSEMHDIQEKQIQDSILQ
AEKLNQMLDGNTNQQRLNQIQSYQRQQNEQMRLSAQGQQEFLASQKIDEQNQNQKTQAAQ
INQQNQQGQSQQNIKNHSVAASPNSQSPINQIQQRSISPQSNSLNSSQITAGQVIQVVKE
ILPPTQQTTIYQKKLSDNAIQSTVVTKTIQPIVTTKIISPVRSRPSSQSNSPLTKQNQNA
LQNNSPGKFNSQIISQQLLPQQVLGQLQSIIGGGNSNQQGQQPANQNKIYSDRTQNRIVQ
AVNQQWKQKNPELFQNITPMEFYQSIVQRQNILKDLSPEQLEQLEQDIKTLKQMNVADDL
QIILEQNISNVTSPLNASNNTDIKHYTFQGDDITPSLQRRKQEEELAATAAKTALDVTAA
AEKARKEYEIQQQHLQNQLALTQNHTLLTQQQQKEIQELKKQQEEFIKQQLEIQKQQAEY
LEKLQKQQALIIQQGEEQRKRHEEEKTRQLKEIEALEKQKNQRIIEEEERLKQLRDMQEM
VRQQIEDDLQRKKLEDEEHRKRQKALFDKEQEILDRLQDEQVKLSQLQQEQARLQAQELE
NKKVRDMQLKMEEELRKKEEEKLEQLKIQSASLNEEIKNNQSRSEEERVKMHQLQLKYAE
DQRKQQEILDELNSQKLLKENSQRQQDIIQQQDILEQQKQINEQQYALQQEQLRIQRERE
ELEILQKQRNEESFINEQQRLAILQSKEQELEQQIRQQNQSFLAQQEELQRQKQQLESQK
LDLILEQDRLKKKSDLDDAKLKDVEKNLQEQLSKIENEKDQQIQRDQEIQARVRQESINA
QQEELQRQKQQIEFQKQDLIIEQERLRQKLKEEEEKRLEAERILQETILKKQLEDSATVQ
LKNQVDLEKLEQQKQIEIKLREQQEQIKREKEQLERERQQQEYEKQKQHEKEKEVIELQN
ALKQKQLFLEQQQRETQLKLEQQFKEQQEQMLREKTEIEKQKIIQEQQKQKQIELEQAAK
QQEERLKQQKLLLELEQEQKKRDAEQQLRFQQEQIQKEKEEVQKQKELLAQMEREKIAME
LARQQKEQEERRKIEEQEKRDNYFKKVDVFTKEIESRRGYISPRQSSLDIPPSTQVILNN
PSTLENKDSSNLLFKTNQSASSSPINTNRSDIETMIRESQARLKQSIAQSVQQVDKIGQI
VNPYQDISIKNSESAEAVKRSTHQPTTTQYPITNTNLQQESQPQKDILESYSQQKNIDLF
NQIDKIVRSASQSASTSPIGTNNNKNNFGDSLDRLNRFTGSQVTQQTPSTEIKNQAQTDL
DLQNRVNQIQNQSKSSESVISALPTPINSVQPIQTKTTQEQKNSSYIPTSDDFRGSLLLN
NLEKSTQNQIRSDLFKSIEGVNSIVSPNSKNQNKSSFGDFSSQNQQQNKVQGVSDYTSYQ
YQSQVSSTPSNPIFQKIEPSALTNNNSANKQPLEKNNQYQLPSSVTFSALPSVTSYMPLT
QSIQQNTVQGEGLLNRLDNKNDNKKQNANSQQNPVSEQIVDSILSEPFAPQPTANFDTRS
SISSIKREPISYPGNTYTASVSGIPIQPYSSWTNPVSLNSSGGTAAFLGLPVSQQNKNSQ
PQTNQNSANQTLFVSFGNEKILGSNPLKSSVPGTNKDQILSGLPTYTPSILMSTSFSKLP
NNSFNQGEKDKQSSVRSSGAVSNEYKQALYQKQNIIPASDQLTAGALKSNPTTYVSNQKP
SINIGNINQGSYTTSSLTGVDAYIPLTTGASALISPRTQELNSYKITTSALVPSSRQVVI
GNPSSIETSDQKYNKRLSITSDVIEEDPKRSNNQDSASKLGNNTLNSSAGFIGYKKKIKI
QPSPQVIKETHLPVIRSNSNNNSKDSSFFLNNNSFSQNNPKIPNPTSVAAGNNNYILNNS
FSNLNNSFSGAPKDTITAGTNFNNFLNSSFTDEKSKQQRNTLDKLNKQGQLNQVNGLIKS
GESQQSQQKISQFNSPQSQKIASQLASTQNLNRFASPQSDTSRGSVSLTKKTNVTVVHTP
GTEGAISLVRAIQNTYTYNEPTHNDDSFHNSSFNNLNKSLLDSQASQYLVYI


>TTHERM_00703320(gene)
ATGAAAGAATAAGAAAGTGGGAATTTAGAAAAAAGAATCAAGCTCATTGAATATAGAAAT
GGTATATACTAAGGTATGATACACCCTAATGAGGATAGAACTAATTTAGGTATATACACA
TGGGATAGTGGTGAAGTTTATTTTGGAGAATGGAAGCATGATATGTTAGATGGAGAAGGT
ATTCTCTTCTTTCCATTTGGAGGTTTTATCCATGGATTCTTTATGAAAAATAAGCTAAAT
GGAGCTGCATTTTTCAAATTTTCAAATGGAGATATTTATGAAGGCTTCTGGAGAAATGGT
AAATTAGAAGGCAATTGTTACAAATATTTTTGTGACGAAGAGAGATGGATTCTCTCTGAT
TATAAGAATGGCGAATTCAAAAAAATAATTTCAAAAGGCGATGGTCAACCTCCTTCATGT
AAAATAATAATTTTAAGATTTTAAGATTATAAAATAAGCTGCCAAGATGCATATCTATCA
AAAAATATTAGAATACAATATTTATAAATTTTAAGATTAGTATAGCATTTATTTTTATAA
GTTTGTAGCAGTCAGCTACAACAACTAGGACTAAAAATATCTAGTTTTTCAAATTTTAAT
TAGCAATAAATAAAAAATAAGCTACTAATTTGAATGAAAAATAAAAATATATTTTAAAAA
TAGATGTATTTAACTACATAACTTCAACTTCAGATATAGCAGTTAAGCACCAAGACGACA
CATTCTAATAAGATGGTCTTAAAATAGAAGCTATTAATTTTAACGATGGAGGATAGTATT
TAGGATTAATTAAAAATAGCATGCCAACAAGTTTAGGTATCTTTAAATATTCTGATGGCA
AATACGACGTTGGATACTATAAAGATGGCAGTCTTGATGGATTAGGAAGATTGAATTTGC
ATAATGGAGATGTTTTTGATGGATTTTTATAGAAAGGATTATTCAATGGTATTGGTGTTT
TCTTTTAAAAATAAAGCTGCTCATGGATATATGGAAACTTTGAAAACAATAAATGTGTCA
ATATTCTTAAAAAAGGATAGGGAGCTTTTCCAATTGAAATAATAGGTAAATAGATTAAAT
TGTGTTTAGTTTACTTAATTTTATTTAAATTGTTTAACAGAAAAATTCAGATCTGAGAAT
CATAGAAAAGCTAAAAAATATATTGACAAGATTACTCCTTTAGACGTTTATTTTGCTCCT
ATGTACAATCACATCCCAATAGGTCCTGAAAAGCATAATTTTTACTTAGATTTAAGTATT
ACTAACCAAGCAAATCTTTCTAATAATGGTGGATCTTAATAAAAAATACCTGAGTAATTA
CCTATGAAAAAGGTTTTGCCTAAAGATCTCACTTCATCTGACTACCAATCACCTCCTTAG
AAAAGAAGTTAATCAAAAGGTAAAACTTAGTAAGTTCCTTTGAAAACTCCTTCTGTTTCA
TCATCATTAGTGAGTTCAGCAAATAGATAAGATAACTAAAACCTCAAAAAAGATAGATAA
TCAAGCAAATCAATAGGTAAATCACAAACTATGCAAGCTTAGTAATAAAACCCTAAAATA
TTCGTCTCTTAATCATCATAGGGATAAGATTTAAAGTAGTCATAATAGCAATAACAAGAT
AAAAAGTCAAATTCTAAGAAAGAAGTTCCTAAAAAATAAAATTTAGTTTCTCCCCCTCCA
AGATAAGGTAGATTAGGTGCTCAGTAATAATAGTCAAATCAATCTTCAGCCAAAAAAAGC
AACTTAAAAAAAGCTAAACAAAATTCCTCTAACTCTAACAAGCAAAGGTCCAGATAGTCA
TCTGTCTCAAAAATTTAAAACGAGAAATAAGTAAAAAAAATTAATAATTTATTTAAAATT
AAAATTAAATTTTAGAGTTATTTAAAATAAATAAAAAAAGTATTTTAGTAATTAATTGTA
AAATTTAGAATAAAAGCCACTTTTTCGAAACCTTAATTCCAAAATTAATTTTAGTTATTA
TAAGGAAATTCATTTTATTCTTATTAAGATTAAAGCTATTTTAAGCAAAAAATAGTTTAA
ACTAAAACGATTGATAAAAAATTTGTTTAGCATTTTTATGAATTTTTGCAAAATATTTTT
ATATAAAAGGAGATAGATTAACAAAGTATTCATGACTATGACAATATGGTGAAGTTAATG
AGCTAGCATTAAGAAGGTTAAATTAATATATCATAATCTTAAGGGTAGAATATAAATTTT
GATGAAGTATTTAATACTGAAAGTAGCCCTAAATCATAGTAGATTTAATAAAGAGAGTTT
AAATAATAAAAGAGTTTAGCATAAATTATAGGTAGTGAAGAGATTGATGAACCAAAATAG
TTTCCCTACTAAAAATCTAAATCAATGGCAGTATTTAATTCTAAGAAATCATCCTAAGCT
TCTTCTGTCAAGCAGTAAAACATTCATGAAATTGGAAATGTGTCTAAAATTTCAGGCATA
GGATAAAGTGACACTTCAGGAGTTTACAAAGACAATAATAGAAGTGGAGTTGCTAATTAG
GGTGATTTTACAGGGATTATTAAACCTAATATATTCGGCAAAAAGTCTTCAAGTGCTCCT
AAATAAGCTAAATAAGTCTAAAATAAGCAAAAAGATGATAAATCAGGAACAAACAATGAG
CAAAGCGATTCTGACTCAAGCTTTAGTTCATATAGCAGTGATAGAGTTGTTAGAAAATAG
ACAGCTCCTCCTACATCTGGTAGAAAATAGATTGCTATAATAAAGGAAGAAGAGAGAATG
AGATCATACTCTGGTACTCCTGCAAATAGATTTGTTGAAAGCTAGTAAATATTTTTTATT
TATTTTACTTAAATTCTAAATTAATTTTTTGCTTTTTAGAAAAAGTACAAATAGAGATTA
TTTTGGCTCTAGAGATGATCAAGTTAGTTCTGGAGGTAAATCGTATAAAAATGAATAGGA
TTTAAGAGAGAGCTTGGAAGAAGAAGAAAATAAATAGTTTTTGGAAGCAGAAAGATTGTC
AAAAGAAGAAGTTGAGAGTAAAATTGAGAGAGCTCATGATAAGAAAAATAACGATTAAGA
TGAAGAATATGGGCATATAAAAATTAAAGATATAATAAATGTTGATGACTAGTCAAATTA
AAATAGCCATGTAGGTGAGCAATCAAGAAAGGGTGCAGATTCAACACCACACAATTAGTT
TATCACTATTCAAAATTAAAAAAATAAGCCTATTCAAATTTAAAAAAATGAATAAATTAT
TTCTGATAAGCAAGGATTTAACCAAATTGAAAAAGATAATGACACTCCAATAAGCAAAAA
ATTAGAGGATTTATAACACCTAGCATAAAATAGAGACATTCAAAAAATGTATTAATCAAA
AAAGAGCAACTCAATTTTAGAATTAGAAAATATCCGAAACGAAATAGCCAACTATGAGCA
AATAGCATAATAAGATTTACCATAAAGAAGCAAAAAATCAAAGTAAGGGAAAAAAGACAC
ATCTAGAGAAACTTCACATCCTCGTACTCCATAATCTATAGTTACTCCTAAACATCTACC
AAGCTAATCCCCAAACTTCTAATAAAGCCCCATTCTAACTAGTCTACCTAATCCTAAAAT
ATAATATTAATAAGAAGAGGAGCTAGATCTTGAAGAATCAGAACATGTTTTAGACTCAAT
AAAGTAGATAAAGCAGTAAATGATTCATCAATTGAATCATTTAGAAAACAAGCAAAGAGA
AGTTACCACTCCTGCAGCATCAAACTTTAAAGTAAATAATCCAACCATTTTAAAAATTTA
ATAAAATTGTTCAAATATATAAAATCTAATTATTTTTTATAAAGTATAATATAGCCCCTA
ATTTTAATATTCCGAATGATGAAAACCACATCTTAAAAGATGATTCCTTAAACTAAGATA
TATCCCCTCAAAATCCTATCGAAAATTTTGAATCTCCTTTCAAAAAAGACAGTCTAGTTT
ATGAAAGAGGTATTTAAGAAAAAATTTTTTAAAATTATTGTTATTATAGGTTATATCATA
ATTTAAACAAAATATATCTTTATTTATATTAACAAAGAAAATAGTCAGGGCAGAGGTAGA
AGCACCAATCATAGCAGAGTAGAAAACAGCAGAAGTTATAAATATTATACTGAGGAGGAG
GCTAACCAGATAGCCTAAAAGATTGAACAAAATCTGGCATTCTAAGGAGATTAAACCAAT
AAACAAACAAAAGTAAGTGAAAATGAGAGAGGAGAAAACTTTATAAATGAAGAAAGTGTG
CAAGTTGGTGACATTAATGAGGAGATTCAAATCGATGATCAAAGAGCCGGTCGTGAAGAT
AGAGTTGTAAGATCAAAGCTAGAAAGAGATTCAGAAATGCATGATATTTAAGAGAAATAA
ATATAAGATTCTATTTTATAAGCAGAAAAACTCAATTAAATGCTTGATGGCAACACAAAT
TAACAAAGATTAAACTAAATTCAATCTTATCAGAGATAATAAAACGAATAAATGAGACTT
AGCGCATAAGGATAGTAAGAATTTTTAGCATCTTAGAAAATAGATGAGTAAAACTAAAAT
CAAAAAACTCAAGCAGCATAAATTAATTAATAAAATTAATAAGGTTAATCTTAATAAAAC
ATAAAAAACCATTCAGTAGCTGCATCACCAAATAGTCAATCTCCAATAAATTAAATTCAA
CAAAGATCAATCAGCCCCCAAAGTAATTCCTTGAATTCAAGTCAAATTACAGCTGGCTAA
GTTATTTAAGTTGTCAAAGAAATACTCCCCCCAACTTAACAAACTACTATTTATTAGAAA
AAGCTAAGTGATAATGCAATTTAATCTACTGTTGTTACTAAAACAATACAGCCAATCGTC
ACAACCAAAATTATTTCACCCGTTCGTTCTCGTCCGTCAAGCTAATCTAACTCTCCTTTA
ACTAAATAAAATTAAAATGCCCTATAAAATAACAGCCCTGGCAAATTTAATAGCCAGATT
ATTTCACAGTAATTACTACCCTAACAAGTACTAGGATAATTACAGTCTATAATAGGAGGA
GGAAATTCTAATCAGTAAGGTTAACAACCTGCAAATTAAAATAAAATTTATTCTGATAGG
ACCCAAAATAGAATAGTGTAAGCCGTTAATTAATAATGGAAGCAAAAAAATCCTGAATTA
TTCTAAAATATAACACCAATGGAGTTTTATTAGAGTATTGTTCAAAGATAAAATATACTA
AAGGACTTAAGTCCTGAACAACTTGAATAGCTTGAATAAGACATAAAAACTTTGAAGCAG
ATGAACGTAGCTGATGACCTTTAGATAATTCTAGAATAAAACATCTCTAATGTTACTTCA
CCTTTGAATGCATCTAATGTAAACTTATAAATTATTGAAAAATTTGAATTTTCACATCGA
TCATGCATGATCTTTATTTTACCCATTAAAACATGACTTTAGCTCATATTTGCTATTTAA
ATTCTTATTTTGAATAATTTTTTTGCATTATTTCATCATTTTTTGTATATTTTAATTGTA
CTTAAAATATTTTTAAGTATTTTCTTCTAAAATTCATCATTGATTTTATTTATATTGAAT
AATAAAAGAACACAGATATTAAACATTACACATTTTAAGGAGATGATATTACTCCCTCTT
TGCAAAGAAGAAAATAAGAAGAAGAATTAGCAGCTACTGCTGCAAAAACTGCATTAGATG
TTACCGCAGCTGCTGAAAAGGCTAGAAAGGAGTATGAAATCTAGCAGCAACATCTGCAAA
ATCAATTAGCTTTAACTCAAAATCACACACTCTTAACTTAATAATAATAGAAAGAAATAT
AAGAACTTAAAAAGTAGTAAGAAGAATTTATTAAGCAACAACTTGAAATACAAAAATAAT
AGGCTGAGTATTTAGAAAAGCTTTAAAAGTAGCAAGCATTAATCATTTAATAAGGAGAAG
AATAGCGTAAACGCCATGAAGAAGAAAAGACTCGCTAGCTTAAGGAAATAGAGGCTCTTG
AGAAATAAAAAAACTAAAGAATCATAGAAGAAGAAGAGAGATTGAAGTAACTACGTGATA
TGCAAGAAATGGTGCGCCAATAGATAGAAGATGATTTACAACGCAAAAAATTAGAAGATG
AAGAGCACAGAAAGCGCTAGAAAGCTCTCTTTGATAAAGAATAAGAAATTCTAGATAGAT
TGCAAGATGAATAGGTAAAACTGTCTTAGCTTTAATAAGAATAGGCCAGGCTTTAGGCTT
AAGAGTTAGAAAATAAAAAAGTAAGAGATATGTAATTAAAAATGGAAGAAGAGCTAAGAA
AGAAGGAGGAAGAAAAATTGGAATAATTAAAGATATAGTCTGCTTCGCTAAATGAAGAGA
TAAAGAATAACCAAAGCAGGAGTGAAGAAGAAAGAGTAAAAATGCATTAACTGTAGTTAA
AATATGCAGAAGATCAAAGAAAATAATAGGAAATCTTAGATGAATTAAATTCATAAAAAT
TACTTAAAGAAAATTCACAACGTTAACAAGATATTATTTAATAATAAGACATACTTGAAT
AGTAGAAATAAATTAATGAGTAACAATATGCTTTGTAGCAGGAATAGCTTAGAATTCAAC
GTGAGCGTGAAGAGTTAGAGATTTTACAAAAATAGAGAAACGAAGAATCTTTCATTAACG
AATAGTAAAGACTTGCTATTTTACAATCAAAGGAATAGGAACTAGAATAATAGATTCGCT
AATAAAATTAGTCTTTCTTAGCCTAATAAGAAGAATTATAACGCTAAAAGTAATAACTAG
AGAGTTAAAAGCTCGATCTCATTTTAGAATAAGACCGTTTAAAGAAGAAGTCAGATCTCG
ATGATGCAAAGTTGAAGGATGTTGAAAAAAATCTATAGGAGTAATTGAGTAAAATAGAGA
ATGAAAAAGACTAGTAAATATAAAGAGATTAAGAAATATAAGCAAGAGTGAGACAAGAAT
CTATAAATGCACAATAGGAAGAGCTTCAGCGTTAAAAATAATAAATTGAATTCTAAAAAT
AAGATCTGATTATAGAGTAAGAGCGCCTCCGTTAAAAATTAAAAGAAGAAGAAGAAAAGA
GATTAGAAGCTGAGCGTATTTTATAGGAAACGATTTTGAAGAAGTAGTTAGAAGATTCAG
CAACTGTTTAATTAAAAAATTAAGTTGATTTAGAAAAATTAGAATAATAGAAGTAAATTG
AAATTAAACTTCGTGAGCAGTAAGAGTAAATTAAGAGAGAGAAAGAACAATTAGAGAGAG
AGCGCTAGTAATAGGAATATGAAAAGCAAAAGCAGCATGAAAAGGAGAAAGAGGTTATTG
AGTTACAGAATGCCTTGAAGTAAAAGTAACTATTTTTAGAATAGTAACAGCGAGAAACAC
AACTTAAATTAGAATAGCAGTTTAAAGAATAGCAAGAATAGATGCTTAGAGAAAAAACCG
AAATAGAAAAATAAAAAATAATTCAGGAACAATAAAAATAAAAGCAAATTGAACTTGAAC
AAGCAGCAAAATAATAAGAAGAACGTTTAAAATAGTAAAAACTATTATTAGAACTAGAAC
AAGAATAAAAAAAAAGAGATGCTGAATAACAGCTTCGTTTCCAACAAGAGCAAATACAAA
AAGAAAAAGAAGAAGTCTAAAAGTAAAAAGAACTTCTTGCTTAAATGGAAAGAGAGAAAA
TTGCTATGGAGTTAGCTCGCTAGCAAAAAGAACAAGAAGAGCGTAGAAAGATAGAAGAAT
AAGAAAAAAGAGATAATTATTTTAAAAAAGTAGATGTATTCACTAAGGAAATAGAATCTA
GAAGAGGTTACATATCACCTCGTTAATCTTCTCTTGATATTCCTCCTTCAACATAAGTAA
TCTTAAATAATCCCAGCACTTTAGAAAATAAAGATAGTTCTAATCTTCTTTTCAAGACAA
ACCAAAGCGCAAGCAGTTCACCTATTAATACAAATCGCTCAGATATCGAAACTATGATTA
GGGAATCCCAAGCTCGCTTAAAGCAATCAATAGCCTAATCTGTCTAGTAAGTTGATAAGA
TAGGATAAATTGTAAATCCTTATTAAGATATTTCAATTAAGAACTCAGAAAGTGCAGAGG
CTGTGAAAAGATCGACACATTAACCAACCACTACATAATATCCTATAACAAATACTAATT
TGTAATAAGAATCTCAGCCCTAAAAAGACATTCTTGAGAGTTACTCTCAGTAAAAAAATA
TCGATTTATTTAACCAAATTGACAAAATAGTGCGTTCAGCTTCTCAATCTGCCTCCACTT
CACCTATAGGCACTAACAACAGTAAATATTATTTGAATTTATTAAAACTTCTTCTAATTC
CAATTCCATTTCTTCAATATTATTTTGAATTTTGTAAAAAAAAATAATTTTGTTAAACAA
TAAAATAAAAAAATTTTGAAAATTTCTCAAATAAGAATTTTATTGATTGGATGTTTGAAC
TAATTTAAAAAACATTTACCATTTTTATTATTTTAATTACTTATTAATTAATTTGGAAGA
ATTTAATAAATCAAAATTTAAATTGTGGACATGATTCACATAGAAATGAAAATTTTTAAT
TTTAAATATTACACTCAATTACTTTAAAAAATTAAAATATTATTTTTTTTCATTGCTTAT
CAATCCTCCATATTGATAATTTCACAGTTACTTAATAGTTCCATGAACTAAAAGTTAATA
AAAAAAGTTTTAAGGAAATATAAAATTTTACATATTTAGTAGACGTCTTATTTAATTTCG
ATCTAGTGAAACTACATCTGAAAATTACAAAATAGAAATAGGAAATTTCATATGTATTTT
TCATAGATCTTTCTATTTTTCCAAATTAAAATTTGTTATTTAATAAAATACTAAATCATT
TATGATTTATATTTACAATAAGATAAAAATAACTTTGGAGATTCTCTAGATAGACTTAAC
AGGTTCACTGGCTCATAAGTTACTTAGTAAACTCCATCAACAGAAATAAAGAATTAGGCT
TAGACTGATCTAGATTTATAAAATAGAGTAAATCAAATATAGAACTAATCTAAATCTAGT
GAATCAGTAATATCTGCGTTACCTACTCCAATAAATTCTGTATAACCAATATAAACAAAA
ACTACTCAAGAATAAAAGAATAGTAGCTACATACCAACATCAGATGATTTTAGAGGTAGT
TTATTGTTAAATAACTTAGAAAAATCTACTCAAAACCAAATAAGAAGCGATCTATTTAAA
AGCATTGAAGGGGTAAATTCAATAGTCTCCCCTAATTCTAAAAACCAAAATAAATCAAGC
TTTGGAGATTTTAGTAGCTAGAACTAATAGCAAAATAAGGTTTAAGGTGTAAGTGACTAC
ACATCCTACCAATACTAATCTTAAGTAAGCAGTACTCCAAGCAATCCTATTTTCCAAAAA
ATAGAACCTTCTGCTTTGACTAATAATAACAGTGCTAATAAATAGCCTTTGGAGAAAAAT
AATTAATACTAATTACCATCTAGTGTTACATTTAGTGCTCTTCCTTCTGTTACTTCTTAT
ATGCCATTAACCCAAAGTATTTAATAAAATACTGTATAGGGTGAAGGATTACTCAATCGT
TTAGATAACAAAAACGATAATAAAAAACAGAATGCAAATTCTTAATAGAATCCAGTTAGT
GAGCAAATAGTAGACAGTATTTTGAGTGAACCTTTTGCTCCTTAGCCAACTGCTAATTTT
GATACCCGCTCTTCAATCAGCTCAATCAAAAGAGAGCCTATTAGTTACCCTGGAAACACA
TATACTGCATCAGTTAGCGGAATTCCAATTTAACCCTATTCATCTTGGACTAATCCAGTA
AGCTTGAACTCGAGTGGAGGAACAGCTGCATTTTTGGGCTTACCAGTTTCATAGTAAAAC
AAAAACTCTCAGCCATAAACTAATTAAAATAGTGCCAACTAAACCTTGTTTGTTTCTTTT
GGTAATGAAAAGATTTTGGGAAGTAATCCATTAAAATCTTCAGTTCCTGGTACTAATAAG
GATTAAATTTTGTCAGGACTACCAACATACACACCATCAATATTGATGAGCACTTCTTTT
AGTAAATTACCAAACAATTCGTTCAACTAAGGAGAAAAAGATAAACAATCATCTGTAAGA
TCATCAGGAGCAGTCTCTAACGAGTATAAGTAAGCCCTCTATTAAAAACAAAATATCATT
CCAGCAAGCGATTAACTTACTGCTGGTGCCCTTAAAAGCAATCCTACTACTTATGTTTCT
AATTAAAAACCTTCAATAAATATTGGTAATATTAACCAAGGTTCTTACACTACTTCTTCT
TTAACTGGAGTCGATGCTTACATTCCACTTACTACTGGTGCTTCTGCTCTGATTTCGCCC
AGAACTCAAGAATTAAATTCCTACAAGATCACCACTTCAGCCCTAGTCCCAAGTAGCAGA
TAAGTTGTAATTGGTAATCCCAGTAGTATTGAAACTTCAGATTAGAAATATAATAAACGC
TTATCAATAACGAGTGATGTCATCGAAGAAGATCCAAAGCGCAGCAACAACTAAGATAGT
GCTTCAAAGCTCGGAAACAATACGCTAAATTCTTCTGCAGGCTTTATCGGTTACAAGAAA
AAAATAAAAATACAGCCATCTCCATAGGTGATAAAGGAAACACATCTTCCTGTAATTCGC
AGTAATTCCAATAATAATAGCAAAGATTCATCATTTTTCCTTAATAACAATTCTTTTTCA
TAAAATAATCCAAAAATACCAAACCCTACTTCTGTAGCTGCAGGTAATAATAACTATATA
TTGAATAATTCTTTCAGCAACTTAAATAACTCATTTTCTGGTGCACCTAAAGACACAATT
ACAGCTGGAACAAATTTCAATAATTTTTTGAATAGCTCATTCACTGATGAGAAATCTAAA
TAACAAAGAAATACTCTTGACAAACTTAATAAATAAGGCTAATTAAATTAGGTAAATGGT
TTAATTAAGAGTGGTGAATCATAATAATCATAATAAAAAATTTCTTAATTCAACTCTCCT
TAATCTTAAAAGATAGCTAGCCAACTTGCCTCTACTTAGAATCTGAATCGTTTTGCATCA
CCTTAATCAGATACTTCGAGAGGATCTGTTTCTTTAACAAAAAAAACTAATGTCACTGTG
GTGCATACTCCAGGAACAGAAGGTGCTATATCCTTAGTTAGAGCCATCTAAAATACTTAC
ACTTATAACGAACCTACTCATAACGATGATAGTTTCCACAATAGCAGTTTTAACAATTTG
AACAAATCACTTCTCGATTCCCAGGCCTCACAATATTTGGTATACATTTGA