Identifiers and Description

Gene Model Identifier

TTHERM_00145690

Standard Name

MRNN07 (Membrane Occupation and Recognition Nexus protein N-terminal)

Aliases

PreTt26777 | 11.m00474 | 3702.m00196

Description

protein with predicted MORN domains localized at the N-terminus of the protein

Genome Browser (Macronucleus)

GBrowse

Genome Browser (Micronucleus)

GBrowse

Gene Ontology Annotations

No Data fetched for Gene Ontology Annotations

Domains

  • ( PF02493 ) MORN repeat
  • ( PF07661 ) MORN repeat variant
  • ( TIGR03057 ) X-X-X-Leu-X-X-Gly heptad repeats
  • ( TIGR01636 ) phage transcriptional regulator, RinA family

Gene Expression Profile

  • Tetrahymena Functional Genomics Database:

TetraMine Data

TTHERM_00145690

WebApollo

Fullscreen View

Tetrahymena Stock Center

No Data fetched for StockID

Homologs (v.2006 protein sequences)

SourceIdentifierScoreDescription
Tetrahymena borealisEI9_04703.19.997093137033517e-262hypothetical protein (1702 aa)
OxytrichaContig1226.1.g1119.997975313387782e-28MORN repeat
Stentor CoeruleusSteCoe_231980.0000000000018795288165390832

General Information

No Data fetched for General Information

Associated Literature

No Data fetched for Associated Literature

Sequences

>TTHERM_00145690(coding)
ATGTTTTTGTGGGATTCAGGAGACTTTTATGTAGGAGAATGGAAAGATAATAAAATTAAT
GGGCAAGGAATTATTTATTTTAGCTCTGGTGGATACTTAGAAGGATAGTTTATCAACTCA
GTTGTTAATAATAAATCATTATTAGTCTTTCCTAATAATGATAAATATTTTGCAAATTGG
AAATAGGGTCATCTTGATGGGAAAGTGACAATGCTATTCAAAGGGACAAAAAAATAAATT
ATAGCTATTTATGAAAATGGATAATTTCGCAAAGTTGAATCTATTAAAGAGAATATTAAA
GAAGTTAAATCTGTGAAAGAATTTTAGTAGAAATATGATATTTCAAAGCTTATTTAAAAA
TATTCAGCGTTACTTTCTAATGGGGTTTCATCTAATAAACTTCAGGATAATCAAGAATAA
ATAATCTTTTCAAAAATTAACTTTTAAGATGGAGGATTTTTTATTGGGATTACTTAAAAT
AATATTCCTAATGGTTTGGGTCTTTTTTAATACTCTGATTAAAAATTTGACTGTGGATTT
TATAAAAATGGCTTCTTAAATGGAAACGGAAGAAAGAACTTTCCTAATGGCGATTTCTAC
GAAGGCTCTTTTAATCAAGGAAAGTTTGAAGGAGAAGGCTTGATCTTCCATAAATTACAA
AATACTTATTATTTTGGAATATTTAAAGATAATATTTTAGTTAATGAACAACAAAAAGGC
GAGGGCTACCCTAAGGAAATGTTAAATAAATAAAAAAATCTAAAACGTCAAAATGGGTTT
AACTATAATGGAGAAGTTGTTTCTCAAGATTGGATGAAATTGTCTATTTTTCATAATTTA
TAATTCATTGGAAATATTGGAAGATAGGATTAGAATAAAGTTCTAAAGTCAAATCAAAAT
TAACCAAATAATTAGTTTTGCCTATCAGCTCACACAACTTCTAGAGTAAAGGATAACACA
TAAAAATATCATTAGAAGAATCTTGATACTGTATATTATTTAAATTAAAAGATGAGAACC
ACTCAAAATGCATAAACTAATACAAAAGTTTCTAAAGAAAACATACTTTAAATGGATAAA
GGAGTTTAAGCTATTCATAGAAAAAATTAAGGAAGCTTAGATTTAACAAGAGTGCCTTGC
ATTGATTAAAACTTCAACAGTTTATAAAAAACAAAAAGCGAATATATGACTTTGTAAACA
TTCAATGATAATAATTTAAGTAATTTTTATATTTAGCTCTAATAACCTCTACAATAGCAG
TAAATTAATTAAGTTTAATCGTAATAACAATAAATTAATTAAACTTAATCATAACAATCG
CTTCCTAATTCATAACAATAACCTAAGAACGAATAATAAGAGGATTTCGATGAAGAATGT
GGTCGGTAAAGAAAATTAAGTACTAAAGCAAGGAGGTAGTCACCTTATTTATCACCTCTC
TCAAGACCTAATTCATCTTAAAAATAAAGCATTGCAATACATAGTCCTCAATTCGAAATT
AAATAAAAGAAAATTTTGAATAGCCCTCAAACTTATAATTTAAATAAGTATAATAAAATG
ATTGGCTATTTCTAATAAAAAAATTTAATAAAAAAGGACCTTTCACTAAATAGTAATTAA
AATTAAGATTTTAGAGCTCAGTCTCCCATTGAAAAAATACAAAAAACAAAAAACTAAAAA
ACTAACCCAATAGATTTGAAAAAACTAAATTAATTTAATAAAAATAATCAACAAAATATT
CATAATATTAACAATAATACTGGATAGTTGTAAAATATTTCTCCTCTAATCACTTAGAAA
TCTCAACCATGTTTGATATTAACAAATTCACCCGAGTCTTATATTAAAATAAGTGAACAT
TAAATTATAAATTAAAGCTCTCAACAAATTCCGTTTAACAATAATTCTGATAATATTTAA
AATGAAAAATCACCCCATAACAAAATAGAAGAAGGTTTTGACTGTGAATCATAAAAAGAT
ATATCAATAGAAGCTCAAAGAACTAAATGCGACTCTCAAGGTGATTTAATTCAATATGAA
AATAATAGAACCTCTTATCTTAGCCAACCTAGTATACAAAAACCAAAAAATTCTATAGCA
ACTGTTGTTAATTTAAATAAGCAACAATCCTATGAAAATAAAGGAATGTCTGCGACACAT
AATTCTTACCTAAACGACACTCCATCAAGATAATCTTATAAAAGCTCAAATTCATAAAAT
AAAGACAAAAGCAAGTAAAATCTATCTTAAAATTAGAAACAATCAATTCCTTTATAATCT
GAAGAAGCGATGAGACATTATTATTAAACGAGAATTAAAAAATAAGCTCCTGAAGAAATT
CATTTAAAAGAATATCATTTAAAAAACAAACTTCAAACAACTCTGTCTACAAAAAATATA
GGTTCTAACAATAGAAATAATAGTAGCAACAGTAATGCTCTTGGATTATTTGAATAAAAG
AATACAACTCAAAACTCTAAGATTAAAGAGATGGAGAAGAAGAAAAACACTTTAGTAAAC
CAAAATAAAAATAAATCAGGTTAAAATTAGTAATAAAAAAGTAAACTTTAAGGAAATAAA
AGTTAGTAGTAAAAGCCACTTAAAGGACTTCTATCAGTCAAATCGTAAGACAACTTAGTA
AAAGATGCTGTCTGTTCTTTTTCAAGCCTGTAAGAATAGTAGGTTGCTGTGACTTAACCA
GATGAATCTTAAAAATCTAAATTTTTTAAAATTGAGTAATTATAAATTTAAGAGGATGAT
TTGTAATTCATACAAGAGCAAGAGTAATAAATAAAAAATGAAATAATTCAAAATGATCAA
AAAAGCCTAGAATAAAGTTACGAGTTTTAAGAAAATAATGAAAATAACGAAAATAAAAAT
TTATTAAATTAAAAGTAAAATTATCAATAGGCAAATATAAGAAAAAGCGATTGTCTTATC
TCAAATTCACCAAAAAAATAAAATGAAAAAGGTATTGAAAATATCAAATTAATGAAGGTA
ATTTCTACTGAAAATGAGATTTAGAATAATGAAAATAGTCAAATAAATAGTAACAAAGAA
CAATCTTAAATTCAAAATAATTTAAAAAGCACTATATCTGATTAAATAAGGCATATTTTA
CATATGCAGAAGGTTTAAAATAACCAAAAGCATAAATTTTCTATGAAACCATTTTTGCTT
TAAGGAAATTAAAGTAAATTTAATTAAAACCAAGAAAACAGAAGAAGTGAGAATTAAATA
TCTTAAACACTCAACTAATTTAGTTAAGAAATTCAAAATTAGAATACATTAAACTTATAG
ATAAAATCAAAATCTAAGATTGATGAAATTTTAATGAAAAAAGAATAATATCAATCCATT
TTTCCAGCAGATAATTTATAAAATAAGTAAGAGAGACATATTCTTACTCCTTTTCATCCT
GCAAAAACTCCATAGCATAAAGAAATATAAAGTACAAACTCATATTAGCTAAAAGCTTAA
ACTAATGAGAGTATAAGATCTTTCAATTAGAAAATGTCTTCGTATATGAGTTTTTAAGAG
AGAATTAATGCTATCGGCTAATGTATTTACAAAAAGGATTGGAATGCAACCTAATCATTT
AATTCAATTGCAAGTCTTAGTCGAAATAACAGTGTAATTATAGAAAAAAATTAAAATTCT
GAAGACAATTTAAATATAATTAATACATTTTCTTCAAATAATATTAATTCTAAAGAAGAA
TTATAATAAAAAAGTGATCAAACAAATTAATTGTGTTAACAACCTTTGTAAAATAATGTT
AATTAGCTAGTTGCTAATTATTTTTAGGCATAAAATAATGTATCAGAATTAAATATCCAA
GTCACATCTAAATAATCAACTAATGAGCAAGATATGCAAAGTGATCCAATCAATATAGTA
GAAAGCAATTTTGACTTAGAAGTTATTAATATTGAACAAGAAAAATAAGAGTCGTCAGTT
GATAGTAAATAAAAGCATGATTATATATTCGATGGGATTGTTTAATCAAACTATAACTCA
TTAGTATCTGAAGAAAAAATCATATTATAACAATTTGAAACAAATTCACTTTAAAGTTCT
TAAAAGTTGAAATGCCTCTAAGAATAAACAAAATAGAGTTAACCAGAGTAATTAACTAAC
CTTCCAGTAGAAAATATAGAGAAATAGCTTTAATATGAGGAACCTTGTAATGATAATTAT
AACTTTGGTATTCTTAAAACAGAAGAAGGAGAGGGAGATTCAATCAATAAAAATGATCTT
GCTTGCCTTTAACTCAAAGGGATGAATGAGTCAGATTTATTTAATGATTAAAGTGAAAAA
TCAAGCAATATAAATGAGCTATAAATTGATTAAAAATTATTTAATGAAGAAGATTTGTTA
GGTTTAAATGCTCTTGATGAAATTTTTTCATAAAACTCAGGATCAATGTGCTCCTTTACA
CCTCCAAAATAATAAGATGTAGGCAAATCTCATTTTAATCAATAATAAAAGGCAAAGGAT
GGACTTTATTTTAATCAAAAAATTGAACAAACAAATGATAAAGATTTAGATTCAGATTTA
GAATTTAAAAATATTTTTAATTTTTAGCTCAATCTCGATAACCTAGATATATTTTCAATC
AACTAAGAAAGTTAAAGCTTTAACAATTAAAACAGTTGCACTACAAACGGCATTAACAAT
TAAAATTCTGGTGAAATAGGTGATTTGTCAGGTTTATCACCAATAAATATGAAAGAAAGT
AATCTAGACGATTAATTCTAATAAGAATAAATGATTACAGAATTTCATTTTTATGAAGAT
CTTCTTTTGCAATAAAAAAATGATATATGTGACCTCAATTAAAAAGAGGAAAATAATAAA
TATAATTAAAAATATAAGCCTATCCTTGAAAGTATCTAAGAGATGGTTGCTGAGGATTAA
TACACTTCACCAAAAAAGAAACAAAAGAATTGTTAACGTTAAACTTCAAAAAGCAACTAA
GATCTTGATTTAATTGTTCAATAAATTTAATTCTGA


>TTHERM_00145690(protein)
MFLWDSGDFYVGEWKDNKINGQGIIYFSSGGYLEGQFINSVVNNKSLLVFPNNDKYFANW
KQGHLDGKVTMLFKGTKKQIIAIYENGQFRKVESIKENIKEVKSVKEFQQKYDISKLIQK
YSALLSNGVSSNKLQDNQEQIIFSKINFQDGGFFIGITQNNIPNGLGLFQYSDQKFDCGF
YKNGFLNGNGRKNFPNGDFYEGSFNQGKFEGEGLIFHKLQNTYYFGIFKDNILVNEQQKG
EGYPKEMLNKQKNLKRQNGFNYNGEVVSQDWMKLSIFHNLQFIGNIGRQDQNKVLKSNQN
QPNNQFCLSAHTTSRVKDNTQKYHQKNLDTVYYLNQKMRTTQNAQTNTKVSKENILQMDK
GVQAIHRKNQGSLDLTRVPCIDQNFNSLQKTKSEYMTLQTFNDNNLSNFYIQLQQPLQQQ
QINQVQSQQQQINQTQSQQSLPNSQQQPKNEQQEDFDEECGRQRKLSTKARRQSPYLSPL
SRPNSSQKQSIAIHSPQFEIKQKKILNSPQTYNLNKYNKMIGYFQQKNLIKKDLSLNSNQ
NQDFRAQSPIEKIQKTKNQKTNPIDLKKLNQFNKNNQQNIHNINNNTGQLQNISPLITQK
SQPCLILTNSPESYIKISEHQIINQSSQQIPFNNNSDNIQNEKSPHNKIEEGFDCESQKD
ISIEAQRTKCDSQGDLIQYENNRTSYLSQPSIQKPKNSIATVVNLNKQQSYENKGMSATH
NSYLNDTPSRQSYKSSNSQNKDKSKQNLSQNQKQSIPLQSEEAMRHYYQTRIKKQAPEEI
HLKEYHLKNKLQTTLSTKNIGSNNRNNSSNSNALGLFEQKNTTQNSKIKEMEKKKNTLVN
QNKNKSGQNQQQKSKLQGNKSQQQKPLKGLLSVKSQDNLVKDAVCSFSSLQEQQVAVTQP
DESQKSKFFKIEQLQIQEDDLQFIQEQEQQIKNEIIQNDQKSLEQSYEFQENNENNENKN
LLNQKQNYQQANIRKSDCLISNSPKKQNEKGIENIKLMKVISTENEIQNNENSQINSNKE
QSQIQNNLKSTISDQIRHILHMQKVQNNQKHKFSMKPFLLQGNQSKFNQNQENRRSENQI
SQTLNQFSQEIQNQNTLNLQIKSKSKIDEILMKKEQYQSIFPADNLQNKQERHILTPFHP
AKTPQHKEIQSTNSYQLKAQTNESIRSFNQKMSSYMSFQERINAIGQCIYKKDWNATQSF
NSIASLSRNNSVIIEKNQNSEDNLNIINTFSSNNINSKEELQQKSDQTNQLCQQPLQNNV
NQLVANYFQAQNNVSELNIQVTSKQSTNEQDMQSDPINIVESNFDLEVINIEQEKQESSV
DSKQKHDYIFDGIVQSNYNSLVSEEKIILQQFETNSLQSSQKLKCLQEQTKQSQPEQLTN
LPVENIEKQLQYEEPCNDNYNFGILKTEEGEGDSINKNDLACLQLKGMNESDLFNDQSEK
SSNINELQIDQKLFNEEDLLGLNALDEIFSQNSGSMCSFTPPKQQDVGKSHFNQQQKAKD
GLYFNQKIEQTNDKDLDSDLEFKNIFNFQLNLDNLDIFSINQESQSFNNQNSCTTNGINN
QNSGEIGDLSGLSPINMKESNLDDQFQQEQMITEFHFYEDLLLQQKNDICDLNQKEENNK
YNQKYKPILESIQEMVAEDQYTSPKKKQKNCQRQTSKSNQDLDLIVQQIQF


>TTHERM_00145690(gene)
AAGAAAGAAGAAAATTCACAAATTAAAGCTCTTTTAATAATTAATTAGTAAAATAATCTT
TAAAATAAGTAGATATTTTTTAACATTTTTAAATGAATAGCAAATTCAAAATATAGCTCT
AAAATGAATAGAATGGGACTTACTAAGGGCTTGTTAACGATTAAAATAAAAAGGATTTAT
TTGGCATGTTTTTGTGGGATTCAGGAGACTTTTATGTAGGTAATAAAATGAAGTGATTTT
GTCTCTTGCTGACATGTTTCAATAAAAAATTTTAGATTAATTATAAATGAAAATCATACT
TAGCAAGATTTACTTACTTTTATTAAGGTATGGTTTGAAATAATGAATATTCTTTAAATA
AACAGGAGAATGGAAAGATAATAAAATTAATGGGCAAGGAATTATTTATTTTAGCTCTGG
TGGATACTTAGAAGGATAGTTTATCAACTCAGTTGTTAATAATAAATCATTATTAGTCTT
TCCTAATAATGATAAATATTTTGCAAATTGGAAATAGGGTCATCTTGATGGGAAAGTGAC
AATGCTATTCAAAGGGACAAAAAAATAAATTATAGCTATTTATGAAAATGGATAATTTCG
CAAAGTTGAATCTATTAAAGAGAATATTAAAGAAGTTAAATGTAAAAATTATTTAGATTT
TCAATTTATTTTAAATAACTTTAGTTAGTGTATTTTTCAAAGTATTAAAGATTAAATCTA
TAAATATATCTTAAGCTTTATCTCATTTTATAATTAAATCAAGCTGTGAAAGAATTTTAG
TAGAAATATGATATTTCAAAGCTTATTTAAAAATATTCAGCGTTACTTTCTAATGGGGTT
TCATCTAATAAACTTCAGGATAATCAAGAATAAATAATCTTTTCAAAAATTAACTTTTAA
GATGGAGGATTTTTTATTGGGATTACTTAAAATAATATTCCTAATGGTTTGGGTCTTTTT
TAATACTCTGATTAAAAATTTGACTGTGGATTTTATAAAGTAAAATTAATATTTCATTTA
TAATTTATTTTTTAAGAGAATTAAAATAAATAAACATTTTAATTTTAAATATTCTTATAC
TATTTCTTTTTCAAAGAATGGCTTCTTAAATGGAAACGGAAGAAAGAACTTTCCTAATGG
CGATTTCTACGAAGGCTCTTTTAATCAAGGAAAGTTTGAAGGAGAAGGCTTGATCTTCCA
TAAATTACAAAATACTTATTATTTTGGAATATTTAAAGATAATATTTTAGTTAATGAACA
ACAAAAAGGCGAGGGCTACCCTAAGGAAATGTTAAGTAAATTAACAATTAAATGTTATAT
GGTTTAAATATATTCAATAATATTAACTTTAAAATTATATACTTATTTTTTTCCTAATTA
AAAATAAATTAAATAAAAAGATAAATAAAAAAATCTAAAACGTCAAAATGGGTTTAACTA
TAATGGAGAAGTTGTTTCTCAAGATTGGATGAAATTGTCTATTTTTCATAATTTATAATT
CATTGGAAATATTGGAAGATAGGATTAGAATAAAGTTCTAAAGTCAAATCAAAATTAACC
AAATAATTAGTTTTGCCTATCAGCTCACACAACTTCTAGAGTAAAGGATAACACATAAAA
ATATCATTAGAAGAATCTTGATACTGTATATTATTTAAATTAAAAGATGAGAACCACTCA
AAATGCATAAACTAATACAAAAGTTTCTAAAGAAAACATACTTTAAATGGATAAAGGAGT
TTAAGCTATTCATAGAAAAAATTAAGGAAGCTTAGATTTAACAAGAGTGCCTTGCATTGA
TTAAAACTTCAACAGTTTATAAAAAACAAAAAGCGAATATATGACTTTGTAAACATTCAA
TGATAATAATTTAAGTAATTTTTATATTTAGCTCTAATAACCTCTACAATAGCAGTAAAT
TAATTAAGTTTAATCGTAATAACAATAAATTAATTAAACTTAATCATAACAATCGCTTCC
TAATTCATAACAATAACCTAAGAACGAATAATAAGAGGATTTCGATGAAGAATGTGGTCG
GTAAAGAAAATTAAGTACTAAAGCAAGGAGGTAGTCACCTTATTTATCACCTCTCTCAAG
ACCTAATTCATCTTAAAAATAAAGCATTGCAATACATAGTCCTCAATTCGAAATTAAATA
AAAGAAAATTTTGAATAGCCCTCAAACTTATAATTTAAATAAGTATAATAAAATGATTGG
CTATTTCTAATAAAAAAATTTAATAAAAAAGGACCTTTCACTAAATAGTAATTAAAATTA
AGATTTTAGAGCTCAGTCTCCCATTGAAAAAATACAAAAAACAAAAAACTAAAAAACTAA
CCCAATAGATTTGAAAAAACTAAATTAATTTAATAAAAATAATCAACAAAATATTCATAA
TATTAACAATAATACTGGATAGTTGTAAAATATTTCTCCTCTAATCACTTAGAAATCTCA
ACCATGTTTGATATTAACAAATTCACCCGAGTCTTATATTAAAATAAGTGAACATTAAAT
TATAAATTAAAGCTCTCAACAAATTCCGTTTAACAATAATTCTGATAATATTTAAAATGA
AAAATCACCCCATAACAAAATAGAAGAAGGTTTTGACTGTGAATCATAAAAAGATATATC
AATAGAAGCTCAAAGAACTAAATGCGACTCTCAAGGTGATTTAATTCAATATGAAAATAA
TAGAACCTCTTATCTTAGCCAACCTAGTATACAAAAACCAAAAAATTCTATAGCAACTGT
TGTTAATTTAAATAAGCAACAATCCTATGAAAATAAAGGAATGTCTGCGACACATAATTC
TTACCTAAACGACACTCCATCAAGATAATCTTATAAAAGCTCAAATTCATAAAATAAAGA
CAAAAGCAAGTAAAATCTATCTTAAAATTAGAAACAATCAATTCCTTTATAATCTGAAGA
AGCGATGAGACATTATTATTAAACGAGAATTAAAAAATAAGCTCCTGAAGAAATTCATTT
AAAAGAATATCATTTAAAAAACAAACTTCAAACAACTCTGTCTACAAAAAATATAGGTTC
TAACAATAGAAATAATAGTAGCAACAGTAATGCTCTTGGATTATTTGAATAAAAGAATAC
AACTCAAAACTCTAAGATTAAAGAGATGGAGAAGAAGAAAAACACTTTAGTAAACCAAAA
TAAAAATAAATCAGGTTAAAATTAGTAATAAAAAAGTAAACTTTAAGGAAATAAAAGTTA
GTAGTAAAAGCCACTTAAAGGACTTCTATCAGTCAAATCGTAAGACAACTTAGTAAAAGA
TGCTGTCTGTTCTTTTTCAAGCCTGTAAGAATAGTAGGTTGCTGTGACTTAACCAGATGA
ATCTTAAAAATCTAAATTTTTTAAAATTGAGTAATTATAAATTTAAGAGGATGATTTGTA
ATTCATACAAGAGCAAGAGTAATAAATAAAAAATGAAATAATTCAAAATGATCAAAAAAG
CCTAGAATAAAGTTACGAGTTTTAAGAAAATAATGAAAATAACGAAAATAAAAATTTATT
AAATTAAAAGTAAAATTATCAATAGGCAAATATAAGAAAAAGCGATTGTCTTATCTCAAA
TTCACCAAAAAAATAAAATGAAAAAGGTATTGAAAATATCAAATTAATGAAGGTAATTTC
TACTGAAAATGAGATTTAGAATAATGAAAATAGTCAAATAAATAGTAACAAAGAACAATC
TTAAATTCAAAATAATTTAAAAAGCACTATATCTGATTAAATAAGGCATATTTTACATAT
GCAGAAGGTTTAAAATAACCAAAAGCATAAATTTTCTATGAAACCATTTTTGCTTTAAGG
AAATTAAAGTAAATTTAATTAAAACCAAGAAAACAGAAGAAGTGAGAATTAAATATCTTA
AACACTCAACTAATTTAGTTAAGAAATTCAAAATTAGAATACATTAAACTTATAGATAAA
ATCAAAATCTAAGATTGATGAAATTTTAATGAAAAAAGAATAATATCAATCCATTTTTCC
AGCAGATAATTTATAAAATAAGTAAGAGAGACATATTCTTACTCCTTTTCATCCTGCAAA
AACTCCATAGCATAAAGAAATATAAAGTACAAACTCATATTAGCTAAAAGCTTAAACTAA
TGAGAGTATAAGATCTTTCAATTAGAAAATGTCTTCGTATATGAGTTTTTAAGAGAGAAT
TAATGCTATCGGCTAATGTATTTACAAAAAGGATTGGAATGCAACCTAATCATTTAATTC
AATTGCAAGTCTTAGTCGAAATAACAGTGTAATTATAGAAAAAAATTAAAATTCTGAAGA
CAATTTAAATATAATTAATACATTTTCTTCAAATAATATTAATTCTAAAGAAGAATTATA
ATAAAAAAGTGATCAAACAAATTAATTGTGTTAACAACCTTTGTAAAATAATGTTAATTA
GCTAGTTGCTAATTATTTTTAGGCATAAAATAATGTATCAGAATTAAATATCCAAGTCAC
ATCTAAATAATCAACTAATGAGCAAGATATGCAAAGTGATCCAATCAATATAGTAGAAAG
CAATTTTGACTTAGAAGTTATTAATATTGAACAAGAAAAATAAGAGTCGTCAGTTGATAG
TAAATAAAAGCATGATTATATATTCGATGGGATTGTTTAATCAAACTATAACTCATTAGT
ATCTGAAGAAAAAATCATATTATAACAATTTGAAACAAATTCACTTTAAAGTTCTTAAAA
GTTGAAATGCCTCTAAGAATAAACAAAATAGAGTTAACCAGAGTAATTAACTAACCTTCC
AGTAGAAAATATAGAGAAATAGCTTTAATATGAGGAACCTTGTAATGATAATTATAACTT
TGGTATTCTTAAAACAGAAGAAGGAGAGGGAGATTCAATCAATAAAAATGATCTTGCTTG
CCTTTAACTCAAAGGGATGAATGAGTCAGATTTATTTAATGATTAAAGTGAAAAATCAAG
CAATATAAATGAGCTATAAATTGATTAAAAATTATTTAATGAAGAAGATTTGTTAGGTTT
AAATGCTCTTGATGAAATTTTTTCATAAAACTCAGGATCAATGTGCTCCTTTACACCTCC
AAAATAATAAGATGTAGGCAAATCTCATTTTAATCAATAATAAAAGGCAAAGGATGGACT
TTATTTTAATCAAAAAATTGAACAAACAAATGATAAAGATTTAGATTCAGATTTAGAATT
TAAAAATATTTTTAATTTTTAGCTCAATCTCGATAACCTAGATATATTTTCAATCAACTA
AGAAAGTTAAAGCTTTAACAATTAAAACAGTTGCACTACAAACGGCATTAACAATTAAAA
TTCTGGTGAAATAGGTGATTTGTCAGGTTTATCACCAATAAATATGAAAGAAAGTAATCT
AGACGATTAATTCTAATAAGAATAAATGATTACAGAATTTCATTTTTATGAAGATCTTCT
TTTGCAATAAAAAAATGATATATGTGACCTCAATTAAAAAGAGGAAAATAATAAATATAA
TTAAAAATATAAGCCTATCCTTGAAAGTATCTAAGAGATGGTTGCTGAGGATTAATACAC
TTCACCAAAAAAGAAACAAAAGAATTGTTAACGTTAAACTTCAAAAAGCAACTAAGATCT
TGATTTAATTGTTCAATAAATTTAATTCTGA