Identifiers and Description

Gene Model Identifier

TTHERM_00058510

Standard Name

MRNN06 (Membrane Occupation and Recognition Nexus protein N-terminal)

Aliases

PreTt13036 | 4.m00435 | 3707.m00080

Description

protein with predicted MORN domains localized at the N-terminus of the protein

Genome Browser (Macronucleus)

GBrowse

Genome Browser (Micronucleus)

GBrowse

Gene Ontology Annotations

No Data fetched for Gene Ontology Annotations

Domains

Gene Expression Profile

  • Tetrahymena Functional Genomics Database:

TetraMine Data

TTHERM_00058510

WebApollo

Fullscreen View

Tetrahymena Stock Center

No Data fetched for StockID

Homologs (v.2006 protein sequences)

SourceIdentifierScoreDescription
Tetrahymena borealisEI9_01954.20.000004000864880866421hypothetical protein (626 aa)

General Information

No Data fetched for General Information

Associated Literature

No Data fetched for Associated Literature

Sequences

>TTHERM_00058510(coding)
ATGAAACAATAGAAAAAACTCTTACTGAAAAAAATTAAAGTAAAAACTTCTCTGACAGTA
AATAAAAAATCTGCAAAAAGTCTTTTACCACCTTTATCAAGAAAAGCTAGTTTATTAGAT
GGATAGAAGGGAAATGCTAATACAGTTTTATCAACTTCAATGCTTAACTCTACACAACCC
TTTAGTAGCTAGTATAATTCTAATACAAGTAGCAACACAACTTTTATTTAGTAAAACTAA
GGAGAATTTTCTAATACTGATAAAAATTCTCAACAAAGTAGTTACTTTAGTAAATTTAGG
TCAACTCAAGAAGTTAATTAAGAAGATAATTCAAATATAGCTCATAGTTAAAGTTTAGTT
AAGAAAGTTAGTTTCTGTGATCAAATCAAAAAAATGAATACCTAGACAAACAAGGCAACG
AATATATAAAACTCTTTTTTGGAACAAATGTAAATCGATACAATAAATGAGATGAAAAAA
AATGATAAAAATAATAATTTAAATAAATCTAAAGAAGAATTAATTCTTCTATATGACTCA
AAAGATTAATAAAAACCTTAACAAAATAATGATTATGAATCGAATAATTACCATTTATTA
TCTTTAAATGATAACAGAAGTGAAATGCAAAAATAAAATATAGATAATTAATCTGTAATT
TTTGAAAAATCAATAGAAATTTATGATAGTAATGAAAATTTATAAGAAATAAGTGCTTAA
AATGAATTTGAAAATTCTTATTTTGAAAGTAATATAAAAAATTTATAAATGCCTAATTTA
GAACAATAAGATTTTAATTAAATTATCAATCAAGACTAATAAAATTTAAACCAAAATAGT
TATCTTGAAATCTCACCCTAGAAGGAATAAAAATAATAAAAAGAAAACCTAAATTCTTCT
TCTCCAAAATTAGGTTCAAGCGAGTTTTCTTTAAATAACAATAATTAAAATGAAAATTCT
TGTCAATATTAACATTAATTGGAAGACAATAATTGCTAATCTATGAAAAAATCAATTTAA
AAAAGTTAATACACATAAAATGATGAAAAATAAGAGTTTGATAAAAAGGAAATATCAAAT
TTTTTAAATAATTCATTTTAAATGAATTAAATTTACAACTAAAATAATGAATAATAAGAA
GAGGAAGAATCAATAAAAAAGCAATCCTAAATACAGTTTAAAGGTTAAGCTAATTTAGAT
TATTGCTACAACTCAAACTAATCCATAGATTATATGACTAAAAGTGTTTAATTTTATGAT
TCAGAAGAAAATTCTATTTAAAACAATAGATCTGACTTTGTAGAAAACAATTAAAATGGT
CTTTAATAAAATATTACGTTTGAGTAATATTTTTAGATTTTATCTTAGAAATAGAATATT
CAATAAGAAAATGGCTAGTTAACACTGACCTTTTCTAAGAATAATGACTCTACTAATTAG
TGTATTGATTTAAAAAATCATAGAGGCACCTTTAATAAAAATGAACAATCCCAAAAATCT
ATTTGTTAAAATTTTTTAGTAGGAATTCCTTAAGATTGTGTGCATTCTCATTATGATATA
TAAGAATAAAAATAAGTAAGAAATGATTTTTCTGCAAAATTGAAATAAATAGTTTAACAT
AAATAACTTCAATTTCATAATTAAAAATAGCAAAGTTAAACTGAAAAAATAGATTAAAAA
ACTATTGTGTCTGAAAATTAAATAATAGACAGCAATATTACAACTGACCCCTCATATTCG
TATCAATAATTTAAATTACAGAACTAAAATTAATAATAGAAAATGCTAACAAGTAACATA
ACCAATGAAAATAGATTCTCTTTCTGTAACAATGCTTCATTTAATGATAATCTTCATCTG
TAAAATTAATCATAAAAAAGCTATTATTACAATAATATTGAACAGGAAGATTAAATCAAG
CAAATTTAAGGAAGAAAAATAAATCAGTAAGAGTTAAATAATGATTTTGAAAATAAAGAA
AATAATTCTTTAAAAAATAAATTTGATAAAACTCAACAAAATTAAAAAGCCAAATCACAA
TAATAAAAAGTTAAAATTGTCTAAATAGACCTATTAAAAGAGCTTTCATAAAATAATCTC
AAATTTGATTAAGATTTTTAAGAGAAAGATAATGTTTATGTTCCTTAAATATTCTATAAT
GAAAATTCACAATATAGGCATTAAGATCACAATTAGTTATCCTAAAATTTATACCTGCTT
TTATAAATCAAATCATAGAAAATAGAATTCTGA


>TTHERM_00058510(protein)
MKQQKKLLLKKIKVKTSLTVNKKSAKSLLPPLSRKASLLDGQKGNANTVLSTSMLNSTQP
FSSQYNSNTSSNTTFIQQNQGEFSNTDKNSQQSSYFSKFRSTQEVNQEDNSNIAHSQSLV
KKVSFCDQIKKMNTQTNKATNIQNSFLEQMQIDTINEMKKNDKNNNLNKSKEELILLYDS
KDQQKPQQNNDYESNNYHLLSLNDNRSEMQKQNIDNQSVIFEKSIEIYDSNENLQEISAQ
NEFENSYFESNIKNLQMPNLEQQDFNQIINQDQQNLNQNSYLEISPQKEQKQQKENLNSS
SPKLGSSEFSLNNNNQNENSCQYQHQLEDNNCQSMKKSIQKSQYTQNDEKQEFDKKEISN
FLNNSFQMNQIYNQNNEQQEEEESIKKQSQIQFKGQANLDYCYNSNQSIDYMTKSVQFYD
SEENSIQNNRSDFVENNQNGLQQNITFEQYFQILSQKQNIQQENGQLTLTFSKNNDSTNQ
CIDLKNHRGTFNKNEQSQKSICQNFLVGIPQDCVHSHYDIQEQKQVRNDFSAKLKQIVQH
KQLQFHNQKQQSQTEKIDQKTIVSENQIIDSNITTDPSYSYQQFKLQNQNQQQKMLTSNI
TNENRFSFCNNASFNDNLHLQNQSQKSYYYNNIEQEDQIKQIQGRKINQQELNNDFENKE
NNSLKNKFDKTQQNQKAKSQQQKVKIVQIDLLKELSQNNLKFDQDFQEKDNVYVPQIFYN
ENSQYRHQDHNQLSQNLYLLLQIKSQKIEF


>TTHERM_00058510(gene)
ATGAAACAATAGAAAAAACTCTTACTGAAAAAAATTAAAGTAAAAACTTCTCTGAGTAAA
ATTAAAATGAAAAAGTAGATTTAGATGCAAAATAAAAAGCAGTAAATAAAAAATCTGCAA
AAAGTCTTTTACCACCTTTATCAAGAAAAGCTAGTTTATTAGATGGATAGAAGGGAAATG
CTAATACAGTTTTATCAACTTCAATGCTTAACTCTACACAACCCTTTAGTAGCTAGTATA
ATTCTAATACAAGTAGCAACACAACTTTTATTTAGTAAAACTAAGGAGAATTTTCTAATA
CTGATAAAAATTCTCAACAAAGTAGTTACTTTAGTAAATTTAGGTCAACTCAAGAAGTTA
ATTAAGAAGATAATTCAAATATAGCTCATAGTTAAAGTTTAGTTAAGAAAGTTAGTTTCT
GTGATCAAATCAAAAAAATGAATACCTAGACAAACAAGGCAACGAATATATAAAACTCTT
TTTTGGAACAAATGTAAATCGATACAATAAATGAGATGAAAAAAAATGATAAAAATAATA
ATTTAAATAAATCTAAAGAAGAATTAATTCTTCTATATGACTCAAAAGATTAATAAAAAC
CTTAACAAAATAATGATTATGAATCGAATAATTACCATTTATTATCTTTAAATGATAACA
GAAGTGAAATGCAAAAATAAAATATAGATAATTAATCTGTAATTTTTGAAAAATCAATAG
AAATTTATGATAGTAATGAAAATTTATAAGAAATAAGTGCTTAAAATGAATTTGAAAATT
CTTATTTTGAAAGTAATATAAAAAATTTATAAATGCCTAATTTAGAACAATAAGATTTTA
ATTAAATTATCAATCAAGACTAATAAAATTTAAACCAAAATAGTTATCTTGAAATCTCAC
CCTAGAAGGAATAAAAATAATAAAAAGAAAACCTAAATTCTTCTTCTCCAAAATTAGGTT
CAAGCGAGTTTTCTTTAAATAACAATAATTAAAATGAAAATTCTTGTCAATATTAACATT
AATTGGAAGACAATAATTGCTAATCTATGAAAAAATCAATTTAAAAAAGTTAATACACAT
AAAATGATGAAAAATAAGAGTTTGATAAAAAGGAAATATCAAATTTTTTAAATAATTCAT
TTTAAATGAATTAAATTTACAACTAAAATAATGAATAATAAGAAGAGGAAGAATCAATAA
AAAAGCAATCCTAAATACAGTTTAAAGGTTAAGCTAATTTAGATTATTGCTACAACTCAA
ACTAATCCATAGATTATATGACTAAAAGTGTTTAATTTTATGATTCAGAAGAAAATTCTA
TTTAAAACAATAGATCTGACTTTGTAGAAAACAATTAAAATGGTCTTTAATAAAATATTA
CGTTTGAGTAATATTTTTAGATTTTATCTTAGAAATAGAATATTCAATAAGAAAATGGCT
AGTTAACACTGACCTTTTCTAAGAATAATGACTCTACTAATTAGTGTATTGATTTAAAAA
ATCATAGAGGCACCTTTAATAAAAATGAACAATCCCAAAAATCTATTTGTTAAAATTTTT
TAGTAGGAATTCCTTAAGATTGTGTGCATTCTCATTATGATATATAAGAATAAAAATAAG
TAAGAAATGATTTTTCTGCAAAATTGAAATAAATAGTTTAACATAAATAACTTCAATTTC
ATAATTAAAAATAGCAAAGTTAAACTGAAAAAATAGATTAAAAAACTATTGTGTCTGAAA
ATTAAATAATAGACAGCAATATTACAACTGACCCCTCATATTCGTATCAATAATTTAAAT
TACAGAACTAAAATTAATAATAGAAAATGCTAACAAGTAACATAACCAATGAAAATAGAT
TCTCTTTCTGTAACAATGCTTCATTTAATGATAATCTTCATCTGTAAAATTAATCATAAA
AAAGCTATTATTACAATAATATTGAACAGGAAGATTAAATCAAGCAAATTTAAGGAAGAA
AAATAAATCAGTAAGAGTTAAATAATGATTTTGAAAATAAAGAAAATAATTCTTTAAAAA
ATAAATTTGATAAAACTCAACAAAATTAAAAAGCCAAATCACAATAATAAAAAGTTAAAA
TTGTCTAAATAGACCTATTAAAAGAGCTTTCATAAAATAATCTCAAATTTGATTAAGATT
TTTAAGAGAAAGATAATGTTTATGTTCCTTAAATATTCTATAATGAAAATTCACAATATA
GGCATTAAGATCACAATTAGTTATCCTAAAATTTATAGTAAGATAATAATCAAAAATAAT
CAAATAAAAATGTTAATAAAGCCTGCTTTTATAAATCAAATCATAGAAAATAGAATTCTG
A