Identifiers and Description

Gene Model Identifier

TTHERM_00632820

Standard Name

MRNN05 (Membrane Occupation and Recognition Nexus protein N-terminal)

Aliases

PreTt27951 | 90.m00115

Description

Protein with predicted MORN domains localized at the N-terminus of the protein. G10 protein

Genome Browser (Macronucleus)

GBrowse

Genome Browser (Micronucleus)

GBrowse

Gene Ontology Annotations

Cellular Component

Domains

Gene Expression Profile

  • Tetrahymena Functional Genomics Database:

Change in Gene Expression

TMHMM

TMHMM

Signal Peptide

Signal Peptide Present?: No
Presense Probability: 11.8%

TetraMine Data

TTHERM_00632820

WebApollo

Fullscreen View

Tetrahymena Stock Center

No Data fetched for StockID

Homologs (v.2006 protein sequences)

SourceIdentifierScoreDescription
Tetrahymena borealisEI9_15783.19.997093137033517e-262hypothetical protein (789 aa)

General Information

No Data fetched for General Information

Associated Literature

No Data fetched for Associated Literature

Sequences

>TTHERM_00632820(coding)
ATGACTTCAAGAAACCCTTTATTTATATCCAAAAGTTTTTTCGAAATTATCCCGCCTGAG
CAAGAAGTGAGAAATGGAATTTATGAGGGATAATTAGTTCAAAATAAAAGATAAGGAAAA
GGGATTTTTATTTGGGATGACTCTTCAGTATATGTAGGTGATTGGCTTAACGATCAGCCT
CACGGAGAAGGTATTCTGTTTTTGAACCATGGCTGCTATGCATTCGGTTCTTTTGAAGGT
GGAAAATTGAATGGTAAGGCTATGGTAAAATTTGCAAATGAAAGCAGGATTTTTGGACAA
TGGAGATAGAACCAGTTAAGAGGAATTTGTTTCTTTTACGACCACGAAAAAAGAGAGTGG
AAAATGTGTGAATTTAAGTAAGGAGTTCTTTTTAGAATACTTGAAATACAAGAAAATTCA
CCAATGGGTTAATAGTCTTAGTTTTTTTCTGCAAGTAGTCCTTATAATTATATTCTGAAT
ACAGATATTCCAATTCCTCTTTTCCCTCAATTTTCAAGAAGAGATTTTGAGTTATTTTCA
TTGAGCAGCATTCTCTAGAGAATCACTAATATTTCTTAAAACACTATCATAGGACAAAAA
TAATTAGCTTTCATAAATCTTGGAGAAGAGCTGAATTATTTTGGTTTAATTTAAAATGGA
ATACCTGAAGGGCTAGGTGTGACTTTATCAGGAGATATTCTGAAAAACATTGGAACTTTC
AAATAATCAATAATGCAAGGTATCGGGAGAATTTACAGTGAAAATGGATTAATTTTTGAT
GGAAACTTTGAAAAAGGACATTTAAGTGGATTAGGGTATTTGTATAACAGTGAAACAAAT
ATATTTTATGAAGGACTTTTCTATGAAAACGAGTGCAATAAATTGTTTAAAAAATCAAAA
GGCTTTCAAATAGAAACTATTATAAAGCAAAGGTAAAATTAGCATAAATAAGGTTGCTGC
TTTAGAAATTAAATACTTGTTTTGGAGATATGTCAAATATTAAATGGTTAAATGCCATTA
TTAAATCTTTTTAGAAACAGCAAATCCTTTAACACTGAGGAAGTTTAATCTATAGTGTAA
GCAGATAATAACCCTATTTACAGTTTTATTTAAGCTAACAAAGAATACATAGAAAATAAA
AGACACAATTGCTTTTTTTATCCAAATTAAATAGTTAATAGATAGTTATTTAATACTTCT
TCTCTTTCTTCTCATCAAGGTTTATAAATAAATTCTTATCCGTATGAAGAATATGAGTTT
TCTCTTCATGAATTTCAAAGATAATTGGAAAAACCTAGATTGAGCACAATAATGGCAGAA
AACTAAAAATTTGAAGAAAAAATTAATAATCCTCAAAATAATTTTAGCAATACTAGCACA
AATAGCATCCTAAACCTTCGTAGCAATATATATCTTAGATAATAAAAGAATTACTCTTCC
CCTGGATAGAATAGGAACCTCTAATCTGCAATAAATTCTAATCAAATGAATACAAAGACT
TCTTCTCCCTTAGAAAAAACTCCAGAAAGCTACGTCTCTTACTTCAATGATTTACAAGCC
TAAACTCCTTAAAGAAAAACCCCTCTATAAAAAAAATATTCAATTGAAAATAGCTCTCTA
GAAAAAAAACAAATGTTTTCAAACACTCAAGGATCAAATCACAATTCAGTTTCGCAGTTT
TCATAAAAAAATCCATATTTTCAAATAATACCACAAAACCAAGAAAATATAGAAAGCTAG
AGAAATTCATCATTAAAAAAAAATTAAAACCAAAATTCTTCAGATAAAAATTATGAAAAT
CCAATGAAGCTTTAAAATCCTTTTTATAATACAAAGACGACAAAAAAATAAGGGAATTGG
CTCTATGAGCAAATAAGAGCTCGAAGTAATACTCCTAATTTGAGATACAACGATGACAGA
AATAATATTAGTAATAATAACACAATCAATATTCATTCTATTGATACAGTAGTTGAAAGA
AACATGTCGAATAATTAAAGTCAAAATTTAAGTTAAAGCTATATTTAAAATAACTCTTTG
AATAGTTTTAATAATTAAAAAAATGGTTTTTATCAAAAAAATAATCATCAACCCAACATT
CAAATGAAGAATTAATAATATTCTTCTATTTAAAATCCATTTAAAAGCTAAATTAATGTG
ACTCATAATACAAGTTATTCTTCAATTAATTAAAACAACAATTTGAATGAGACAAAAAAC
CAAATGAGCAACCAATATATTCCTAAGAGCAAAATTTTCAATAGACCTAAAAGCAGTTTA
AATCAGATGACATAAAATATGCAACAATAGTAGATTTCTTAAAGAGAACTTGCCTAACCT
ATTAGATTTTAGACCACAAATGAAAGTATCAGTAAAAGAAGCATTTCTCCTTTTTAGAGC
TACAACACTTCTTATAATTAATAATAAAACAACAGGAGTAGGAGTACTTCAAAACAGGTC
TCACCACTTAGAACTAAGCAAAAATCTAATAACAATTTTTCTCCAATAGTATAAAATATT
TATAGAAAAAATAGCTCCTCATAAAATAAATTGTTTTAATAATAAACAACTCAGCAAAGA
GATTCAAAAGATTTGACTAATTAAAATAGTTTCATTTAAAAAAACAAAAAAATGTAACAA
AAGAAACAAAAAGAAAATATAAAATAAGTTCATCTTCGACTCCCAAGCTCTTTTTTTAAG
TGA


>TTHERM_00632820(protein)
MTSRNPLFISKSFFEIIPPEQEVRNGIYEGQLVQNKRQGKGIFIWDDSSVYVGDWLNDQP
HGEGILFLNHGCYAFGSFEGGKLNGKAMVKFANESRIFGQWRQNQLRGICFFYDHEKREW
KMCEFKQGVLFRILEIQENSPMGQQSQFFSASSPYNYILNTDIPIPLFPQFSRRDFELFS
LSSILQRITNISQNTIIGQKQLAFINLGEELNYFGLIQNGIPEGLGVTLSGDILKNIGTF
KQSIMQGIGRIYSENGLIFDGNFEKGHLSGLGYLYNSETNIFYEGLFYENECNKLFKKSK
GFQIETIIKQRQNQHKQGCCFRNQILVLEICQILNGQMPLLNLFRNSKSFNTEEVQSIVQ
ADNNPIYSFIQANKEYIENKRHNCFFYPNQIVNRQLFNTSSLSSHQGLQINSYPYEEYEF
SLHEFQRQLEKPRLSTIMAENQKFEEKINNPQNNFSNTSTNSILNLRSNIYLRQQKNYSS
PGQNRNLQSAINSNQMNTKTSSPLEKTPESYVSYFNDLQAQTPQRKTPLQKKYSIENSSL
EKKQMFSNTQGSNHNSVSQFSQKNPYFQIIPQNQENIESQRNSSLKKNQNQNSSDKNYEN
PMKLQNPFYNTKTTKKQGNWLYEQIRARSNTPNLRYNDDRNNISNNNTINIHSIDTVVER
NMSNNQSQNLSQSYIQNNSLNSFNNQKNGFYQKNNHQPNIQMKNQQYSSIQNPFKSQINV
THNTSYSSINQNNNLNETKNQMSNQYIPKSKIFNRPKSSLNQMTQNMQQQQISQRELAQP
IRFQTTNESISKRSISPFQSYNTSYNQQQNNRSRSTSKQVSPLRTKQKSNNNFSPIVQNI
YRKNSSSQNKLFQQQTTQQRDSKDLTNQNSFIQKNKKMQQKKQKENIKQVHLRLPSSFFK


>TTHERM_00632820(gene)
ATGACTTCAAGAAACCCTTTATTTATATCCAAAAGTTTTTTCGAAATTATCCCGCCTGAG
CAAGGTAAAATGCAATTAAAATGAATTCAACGAGTTATCATTTAGAAACTTGTTCATATC
TAAGAAAAGACATGATGAAAAAACTTATTTTATTTTAAAATTGAAAATAATTAGATGTGA
TTTACACAGAAGTGAGAAATGGAATTTATGAGGGATAATTAGTTCAAAATAAAAGATAAG
GAAAAGGGATTTTTATTTGGGATGACTCTTCAGTATATGTAGGTATTTACTAACAGTTTT
AATTTATATTTTAGAAGAATTCATAATTTTTATTCTCACATTTAACATCAAACATATTTA
TATTAATTAGGTGATTGGCTTAACGATCAGCCTCACGGAGAAGGTATTCTGTTTTTGAAC
CATGGCTGCTATGCATTCGGTTCTTTTGAAGGTGGAAAATTGAATGGTAAGGCTATGGTA
AAATTTGCAAATGAAAGCAGGATTTTTGGACAATGGAGATAGAACCAGTTAAGAGGAATT
TGTTTCTTTTACGACCACGAAAAAAGAGAGTGGAAAATGTGTGAATTTAAGTAAGGAGTT
CTTTTTAGAATACTTGAAATACAAGAAAATTCACCAATGGGTTAATAGTCTTAGTTTTTT
TCTGCAAGTAGTCCTTATAATTATATTCTGAATACAGATATTCCAATTCCTCTTTTCCCT
CAATTTTCAAGAAGAGATTTTGAGTTATTTTCATTGAGCAGCATTCTCTAGAGAATCACT
AATATTTCTTAAAACACTATCATAGTAAATTAATATTTTCGCTTTCTAAACATTTCTAAC
TTCTTTCTGTATTTATTTATCTATTAATTTTGTTATTACACAGGGACAAAAATAATTAGC
TTTCATAAATCTTGGAGAAGAGCTGAATTATTTTGGTTTAATTTAAAATGGAATACCTGA
AGGGCTAGGTGTGACTTTATCAGGAGATATTCTGAAAAACATTGGAACTTTCAAAGTAAT
GTTTAAAAAAAATATTTTAATATTATTTAAAATAATGAATTCTTTTTGAAGTAATCAATA
ATGCAAGGTATCGGGAGAATTTACAGTGAAAATGGATTAATTTTTGATGGAAACTTTGAA
AAAGGACATTTAAGTGGATTAGGGTATTTGTATAACAGTGAAACAAATATATTTTATGAA
GGACTTTTCTATGAAAACGAGTGCAATAAATTGTTTAAAAAATCAAAAGGCTTTCAAATA
GAAACTATTATAAAGCAAAGGTAAAATTAGCATAAATAAGGTTGCTGCTTTAGAAATTAA
ATACTTGTTTTGGAGATATGTCAAATATTAAATGGTTAAATGCCATTATTAAATCTTTTT
AGAAACAGCAAATCCTTTAACACTGAGGAAGTTTAATCTATAGTGTAAGCAGATAATAAC
CCTATTTACAGTTTTATTTAAGCTAACAAAGAATACATAGAAAATAAAAGACACAATTGC
TTTTTTTATCCAAATTAAATAGTTAATAGATAGTTATTTAATACTTCTTCTCTTTCTTCT
CATCAAGGTTTATAAATAAATTCTTATCCGTATGAAGAATATGAGTTTTCTCTTCATGAA
TTTCAAAGATAATTGGAAAAACCTAGATTGAGCACAATAATGGCAGAAAACTAAAAATTT
GAAGAAAAAATTAATAATCCTCAAAATAATTTTAGCAATACTAGCACAAATAGCATCCTA
AACCTTCGTAGCAATATATATCTTAGATAATAAAAGAATTACTCTTCCCCTGGATAGAAT
AGGAACCTCTAATCTGCAATAAATTCTAATCAAATGAATACAAAGACTTCTTCTCCCTTA
GAAAAAACTCCAGAAAGCTACGTCTCTTACTTCAATGATTTACAAGCCTAAACTCCTTAA
AGAAAAACCCCTCTATAAAAAAAATATTCAATTGAAAATAGCTCTCTAGAAAAAAAACAA
ATGTTTTCAAACACTCAAGGATCAAATCACAATTCAGTTTCGCAGTTTTCATAAAAAAAT
CCATATTTTCAAATAATACCACAAAACCAAGAAAATATAGAAAGCTAGAGAAATTCATCA
TTAAAAAAAAATTAAAACCAAAATTCTTCAGATAAAAATTATGTAAAATTTTTTTATTTT
CTTTTTCAAAAGTCATTCTTTTCTTTTTAAAAATCAATTTACTTAGAAAATAAAAATAGT
TTTTAATAAAAAATGAGTATTTTGTGATTTAAATTAATTAAAGAAGCTAGGATTTTATTT
AAAAATATTTAATTGATAGCTATGATGGATATGATTTAGAAATTAAATTTATTGATAAGT
TTCTATTGATTTTCAGAATAACTTTTCAAACTAAAAAATTAATACAAAACAAATTCAATT
TTTAAATGAAAATAAAAAAAGAAATAATTAATTTTTTTAATTTAATTAATAAATTTTAAA
TGGGAATTTTGATATTTTGATATTTAATTTTAATTATTTGAATGAATTTTATTAATAAAT
TATAAAAAATCATAGGAAAATCCAATGAAGCTTTAAAATCCTTTTTATAATACAAAGACG
ACAAAAAAATAAGGGAATTGGCTCTATGAGCAAATAAGAGCTCGAAGTAATACTCCTAAT
TTGAGATACAACGATGACAGAAATAATATTAGTAATAATAACACAATCAATATTCATTCT
ATTGATACAGTAGTTGAAAGAAACATGTCGAATAATTAAAGTCAAAATTTAAGTTAAAGC
TATATTTAAAATAACTCTTTGAATAGTTTTAATAATTAAAAAAATGGTTTTTATCAAAAA
AATAATCATCAACCCAACATTCAAATGAAGAATTAATAATATTCTTCTATTTAAAATCCA
TTTAAAAGCTAAATTAATGTGACTCATAATACAAGTTATTCTTCAATTAATTAAAACAAC
AATTTGAATGAGACAAAAAACCAAATGAGCAACCAATATATTCCTAAGAGCAAAATTTTC
AATAGACCTAAAAGCAGTTTAAATCAGATGACATAAAATATGCAACAATAGTAGATTTCT
TAAAGAGAACTTGCCTAACCTATTAGATTTTAGACCACAAATGAAAGTATCAGTAAAAGA
AGCATTTCTCCTTTTTAGAGCTACAACACTTCTTATAATTAATAATAAAACAACAGGAGT
AGGAGTACTTCAAAACAGGTCTCACCACTTAGAACTAAGCAAAAATCTAATAACAATTTT
TCTCCAATAGTATAAAATATTTATAGAAAAAATAGCTCCTCATAAAATAAATTGTTTTAA
TAATAAACAACTCAGCAAAGAGATTCAAAAGATTTGACTAATTAAAATAGTTTCATTTAA
AAAAACAAAAAAATGTAACAAAAGAAACAAAAAGAAAATATAAAATAAGTTCATCTTCGA
CTCCCAAGCTCTTTTTTTAAGTGA