Identifiers and Description

Gene Model Identifier

TTHERM_00324550

Standard Name

MRNN04 (Membrane Occupation and Recognition Nexus protein N-terminal)

Aliases

PreTt16060 | 32.m00304

Description

protein with predicted MORN domains localized at the N-terminus of the protein

Genome Browser (Macronucleus)

GBrowse

Genome Browser (Micronucleus)

GBrowse

Gene Ontology Annotations

No Data fetched for Gene Ontology Annotations

Domains

Gene Expression Profile

  • Tetrahymena Functional Genomics Database:

TetraMine Data

TTHERM_00324550

WebApollo

Fullscreen View

Tetrahymena Stock Center

No Data fetched for StockID

Homologs (v.2006 protein sequences)

SourceIdentifierScoreDescription
Tetrahymena borealisEI9_10022.17.001733352475241e-137hypothetical protein (197 aa)
OxytrichaContig6382.0.g247.996716697404228e-65MORN repeat
Stentor CoeruleusSteCoe_267321.185064864233981e-27

General Information

No Data fetched for General Information

Associated Literature

No Data fetched for Associated Literature

Sequences

>TTHERM_00324550(coding)
ATGTTAAACAAATAACAAAAGTAATCAATTTGGTCAGGTAGTGTTTATGAAGGGGACATG
AAAGATGGATGGTATCACGGAAAAGGAAAATTCAAATACCCTAATGGAGTAATTTATGAA
GGAGATTTTGTTAAAGGTCAATTTCATGGAGAAGGAATATTGATATATCCAAATGGTGGT
AAATATAAAGCACATTGGGAACATGGCAAAATGATTAAGGGCGATTATTACTTTTAAGAT
AATTTAAAATACGAATCAGAATAATGGAATTATTGCTAGGGTGAAGACAGAAGATTCTAT
CCTGAAATGTTAAATGGTATTAAACCTGCAGGTGCTACTTAAATGACAAAAGAAGAAAAA
GCACCACATGACATACCTGAAGGGACTTATGATGTTGGTGAAGGTTATTATGAGCCTATA
AAATCTATTATATATGAATATGATGGTAAGATACTTAGAACTCCAAGTGAGGCAGAAGTA
GAAAACATTCTTAAAAAGTGCAGATATAACCCAAGAAAATCATTAGTTATAACAGGAGAA
AACGATAAGATTATTAAAAGTGTAACAGATCCTTCAAAATAAAATAAAATTTGA


>TTHERM_00324550(protein)
MLNKQQKQSIWSGSVYEGDMKDGWYHGKGKFKYPNGVIYEGDFVKGQFHGEGILIYPNGG
KYKAHWEHGKMIKGDYYFQDNLKYESEQWNYCQGEDRRFYPEMLNGIKPAGATQMTKEEK
APHDIPEGTYDVGEGYYEPIKSIIYEYDGKILRTPSEAEVENILKKCRYNPRKSLVITGE
NDKIIKSVTDPSKQNKI


>TTHERM_00324550(gene)
ATGTTAAACAAATAACAAAAGTAATCAATTTGGTCAGGTAGTGTTTATGAAGGGGACATG
AAAGATGGATGGTATCACGGAAAAGGTAAAAAAATGAGCTATTCTTTTCATATAAAAGCA
AAGATTTTCTCTGAAAATAGAAGATTATTTTAAATTTAACGAAAAATATTTATTAAATCT
AAATTATTTTTACTCTGTGATTAGGAAAATTCAAATACCCTAATGGAGTAATTTATGAAG
GAGATTTTGTTAAAGGTCAATTTCATGGAGAAGGAATATTGATATGTAGCTTTGATTTAT
CTTTCAAATGATTACTGTATAATTTTATTTTTCAAAGATCCAAATGGTGGTAAATATAAA
GCACATTGGGAACATGGCAAAATGATTAAGGGCGATTATTACTTTTAAGATAATTTAAAA
TACGAATCAGAATAATGGAATTATTGCTAGGGTGAAGACAGAAGATTCTATCCTGAAATG
TTAAATGGTATTAAACCTGCAGGTGCTACTTAAATGACAAAAGAAGAAAAAGCACCACAT
GACATACCTGAAGGGACTTATGGTAATTAAAACAATAAATTTACATATAATTTTACAAAT
AATATATTTCTCTACTCTATTTTTAGTATTTAGGTTTGATTATTTTAAGAGTATTTAAAA
ATTGAAGCTTAAATATTAAGTTATTTCTACTTTTTATTACATTTATTTTTTTAATGAAAA
CTAATTTATGAATAATCAATCAAAAATGATTAATTTATTTAATAGATGTTGGTGAAGGTT
ATTATGAGCCTATAAAATCTATTATATATGAATATGATGGTAAGATACTTAGAACTCCAA
GTGAGGCAGAAGTAAATTAGTTTAAAATTATTTTGAGCAAAATTAATTTGAAGTTGAATA
AATAACAAAGGTAGAAAACATTCTTAAAAAGTGCAGATATAACCCAAGAAAATCATTAGT
TATAACAGGAGAAAACGATAAGATTATTAAAAGTGTAACAGATCCTTCAAAATAAAATAA
AATTTGA