Identifiers and Description

Gene Model Identifier

TTHERM_00334370

Standard Name

MRNN02 (Membrane Occupation and Recognition Nexus protein N-terminal)

Aliases

PreTt05982 | 34.m00219 | 3689.m00017

Description

MORN domain protein

Genome Browser (Macronucleus)

GBrowse

Genome Browser (Micronucleus)

GBrowse

Gene Ontology Annotations

No Data fetched for Gene Ontology Annotations

Domains

Gene Expression Profile

  • Tetrahymena Functional Genomics Database:

Change in Gene Expression

TMHMM

TMHMM

Signal Peptide

Signal Peptide Present?: No
Presense Probability: 9.9%

TetraMine Data

TTHERM_00334370

WebApollo

Fullscreen View

Tetrahymena Stock Center

No Data fetched for StockID

Homologs (v.2006 protein sequences)

SourceIdentifierScoreDescription
Tetrahymena borealisEI9_16027.12.000214949834694e-50hypothetical protein (128 aa)
OxytrichaContig1226.1.g1117.996041293534585e-17MORN repeat
Stentor CoeruleusSteCoe_231980.000000002061153622438558

General Information

No Data fetched for General Information

Associated Literature

No Data fetched for Associated Literature

Sequences

>TTHERM_00334370(coding)
ATGAACAATTAGTCATTTTAAAATATTTCATAGCAGCATAATCTATCTTCTTTAAATAAC
AAAACTTATTTTGAGTACTCTTTCAATAAGTTGAGGGAAAAATAAGGCTTTTCGCAAAAA
GATGAGTTTATGTATGCCTAAAAGCAGCTAAATTTAAATCTAGGGAATTATTTATATGAG
TACTAAAAATAAAAATTGTATGAATCATGGATAACCAGTGATAAGATATAATAGTTACCT
CAAGAAAGGAGAGATAAAAAAGCTGGAAAGTACCAATAAAACGAGAGTTATAATAGGCAA
CAATCTGTAAAGAGCCTTAAAAAATCAATAGCTAAAAGCGCATCCTATCCATAATATATT
GAGTAAATAAATGGTATTTATGAAGGAGATTTAGATATGAATTATAAAAAGGAAGGACTA
GGAATATTTATTGAAGATCAAGGTGAGATGTATATTGGTGAATGGTCTAACGATTAAATG
CACGGTGAAGGCATTTTGCACTTCCGTTTCGGTGGTTATTTATATGGGAGGTTTAAATAG
AATAAGGTTCATGGCATTGCAATATTAAATATTCCATTAAAAAACCAATTATTTATTGGT
TATTGGAAACAATCTACTTTGAATGGTGTTTGCTTTGAACTTAATTTAAATTCTAGATAG
TGGTCTCTCTCTATTTATGAAAATGGAGAGCTAAAGGAAAAATAGCAAACCGAAGCTTTA
GAAATGAATTCATCTGGAATGGTTTACCCTAAGATTATGGACCCTTATGAAGATATAAAA
TTTTGGATGAGTAGATAGTCAAACAAGCAATATTTCTTAGAAAGAAATATTAATACTTAG
TAAAAGCACATTAAATACATAAACATCGATAAAGGAATGGATTATATAGGATTCATTGAA
GAAAACAATATCCCAGAGGGATTGGGTCTTGTTAAATGTGAAAAAGGGTTTATTTATGGA
TAATTTTGTAATGGCATTTTAGAAGGCTATGGAAGGATGGTGCTTGATAACGGAGATATT
TACGATGGCTATTACAGGAAGGGACAATTGAATGGGCAAGGATACTATTTTAATTTTGAA
AAAAAGATTTTCATGCATGCTATTTTTGAGGATAACATACCAAAGATCTATGAAACAGAG
AATAAATATCGTGCTGACTTAATAAAAAAAGAAAGATCTGAGCAGCATAAGTCTCATAGG
AAATTTTATGCGAAAGAGCAGCATTTAGAAAAACTTGTTTTTAAAATATTAAAAAACTAT
GAAGATTTTTATGGAAAGGGTTAATTATAGTTTGAAAGTGATATAAATAACATGTATTTG
TAAAATAGAATAAATAACAGTTTTACAACAAGAAACTTTATGGATAATAATATTTCTCAA
TCTCCAAACGTGTAATTTACCTAGATTGCTTCTCCTACTAGTCAAAGAAGTTTAGATATT
ACTACAGAAAAATTAGCTGAATCTTTATAACCTTCATAAATTCCTCAAATTTCTCAAACT
ATTTAACAGTAAAATGTTATTAATAATTAATCTCTAAATTAGGTAGCAGCATAAAATCAA
TAAAATAACCCAAATAATAAAATAATCAATAATTAAAGTTAGCAACCAACAAGCTAATTA
GCATAACCTTAGATTAACTAAACATAAAATTAACAAAAAAGTATATCCTTAAATAATTCT
AACAGCATTTAAGGAAATTTAAATAATTAAAATTTATTATCAAACAATCAAAATAATACA
AGTGGAATTATTTAAAACTAGCAAACAGCATCATTTTCTTAATAATAAATATAATAACAA
TAGTAGTTAAATTAATAGCAGTAGTAATTAAATTTATAGCAGTTATAGCAGCAATAATAG
CTAAATCAATAATAATTGCAGTTATAAAATCAATAGCAGTAATAAGTTAACATGTAGCAG
TAATAGTAGCAAAACTAAGTTTAATAGATTACTTTAATCTAAAATGAATCTGGCGTTTAA
TTATCATAATAATCTTTCTCTGAAAATGTTGTTGATTCACCAGTTAAGATGGAAAATAAA
AATGAAGTAAAGTCTAACTTGATAGCAGGTAGCGTGATTTAAGGTATCAGATAGACTGCT
AAACCTTAGAAAAGAGAGTCAAAGTACATTGAACCCCCTAGTATTAAAAAACCTCAAGAA
TTGCAATATAATGCTTCTTAGGAGTAATATGAAAGGTTTTAAAAAATGTAAGAAACAAGA
AAGTAGTATACTGCTCAGCATTAATATTAAAATGAAACAGAGTTCAGTTTAGAAGTGGAC
CCTTCCAAAGATTTATTTTCATTTAAAAAAATTAATACAAGCTATATGGAGAGAAGTTAG
AAAAGAAGAATATTTGAGGATAACCCTCGTTATCAAAAAGAAGTATTTTAATAGTCTCGT
TCTATGACTCCTCATAAAGAATTATTGAGAGATGATTCTGCTAGGAGTACTTTAAGTTAG
TAAAGATATAGAAAAAATGAGTATATGAAAGACATAAATACTCAATAGAAAAATAGGAAC
TAGCAAACCATGTAAAAGGGTATAGTTATAACTCATGACGAAGAATAAAAAGTATGGGAA
AACGATTTTATAGGAAACAAGGAAGAAAATATTGATAATAATGTTGAGCATTTTTGTATT
TTAATAAGAGACCAATAAAAGAATGATAAAAAACAACAAAATTCTCAACAAAATTAACAA
TATTAAGGAAATGATTTTAATAACTAAAATGTAAGGCGTTAAAAAATATTTTAAAATAAT
GCTTCATAGAAATTTGTTGACGATGATTTCTAGTAAGAGAATATTTCATCTAGAAACATG
ATGAGCTCCAAGATAATAGATTAAAAGCTTCAATAAAAATTATAGTAAAATAAAGAAAAT
GGAAAGAAACTTCAAGAAATAGAATATGATAATAATAATAGTAATAACAATATTAATATT
TATTAAGATTAACTTGATATGTCAGACCAAGAAAATAAATAATACTTAGAAAAATATGTG
TTTTCCTTGGTTGAAAAATTTACTCAAGAAAATAATTAAAATTCAAAGCTAAAGCCTATT
GAACATCAAAACTTTGAGAAATCGAGAAATGAAAGTAAATATTTTAAAAATGAATTTAGG
CTTAAAGAATAAGATAGTATTATCAAATCTAGTAATACTCCTTCAAAAGATTAAAAACAA
AATAAAAAAAAGATTTTTGATAAAATACAAGAAATCCACCTAGAAAAAAGCAATATTAAA
AGTTTATAACAAGAGAATCAATCAGTAAGAAGAGATGATGATACCTTTGATTATGCAGAT
GGACCAAATCTATCTTAAGGCTTACAAAACTCTCTAAGGGATGTATAAAACTTTTAATAA
AGCTATCTTAGAAAAAGCCAAATTCAAAATTTAAAACCTAATACATAAAGAAGTTAATAT
GAAAATAATTCATAGTTTTTAGCTACTGATAGATAAGATTTTCAATAAAATTCATAGTAA
TCAACTGGTTACCCTTACAAATCTTAATAATTTTTTTACAATATGTCACCATAAACTAAT
AACGATTTCTAATGA


>TTHERM_00334370(protein)
MNNQSFQNISQQHNLSSLNNKTYFEYSFNKLREKQGFSQKDEFMYAQKQLNLNLGNYLYE
YQKQKLYESWITSDKIQQLPQERRDKKAGKYQQNESYNRQQSVKSLKKSIAKSASYPQYI
EQINGIYEGDLDMNYKKEGLGIFIEDQGEMYIGEWSNDQMHGEGILHFRFGGYLYGRFKQ
NKVHGIAILNIPLKNQLFIGYWKQSTLNGVCFELNLNSRQWSLSIYENGELKEKQQTEAL
EMNSSGMVYPKIMDPYEDIKFWMSRQSNKQYFLERNINTQQKHIKYINIDKGMDYIGFIE
ENNIPEGLGLVKCEKGFIYGQFCNGILEGYGRMVLDNGDIYDGYYRKGQLNGQGYYFNFE
KKIFMHAIFEDNIPKIYETENKYRADLIKKERSEQHKSHRKFYAKEQHLEKLVFKILKNY
EDFYGKGQLQFESDINNMYLQNRINNSFTTRNFMDNNISQSPNVQFTQIASPTSQRSLDI
TTEKLAESLQPSQIPQISQTIQQQNVINNQSLNQVAAQNQQNNPNNKIINNQSQQPTSQL
AQPQINQTQNQQKSISLNNSNSIQGNLNNQNLLSNNQNNTSGIIQNQQTASFSQQQIQQQ
QQLNQQQQQLNLQQLQQQQQLNQQQLQLQNQQQQQVNMQQQQQQNQVQQITLIQNESGVQ
LSQQSFSENVVDSPVKMENKNEVKSNLIAGSVIQGIRQTAKPQKRESKYIEPPSIKKPQE
LQYNASQEQYERFQKMQETRKQYTAQHQYQNETEFSLEVDPSKDLFSFKKINTSYMERSQ
KRRIFEDNPRYQKEVFQQSRSMTPHKELLRDDSARSTLSQQRYRKNEYMKDINTQQKNRN
QQTMQKGIVITHDEEQKVWENDFIGNKEENIDNNVEHFCILIRDQQKNDKKQQNSQQNQQ
YQGNDFNNQNVRRQKIFQNNASQKFVDDDFQQENISSRNMMSSKIIDQKLQQKLQQNKEN
GKKLQEIEYDNNNSNNNINIYQDQLDMSDQENKQYLEKYVFSLVEKFTQENNQNSKLKPI
EHQNFEKSRNESKYFKNEFRLKEQDSIIKSSNTPSKDQKQNKKKIFDKIQEIHLEKSNIK
SLQQENQSVRRDDDTFDYADGPNLSQGLQNSLRDVQNFQQSYLRKSQIQNLKPNTQRSQY
ENNSQFLATDRQDFQQNSQQSTGYPYKSQQFFYNMSPQTNNDFQ


>TTHERM_00334370(gene)
ATGAACAATTAGTCATTTTAAAATATTTCATAGCAGCATAATCTATCTTCTTTAAATAAC
AAAACTTATTTTGAGTACTCTTTCAATAAGTTGAGGGAAAAATAAGGCTTTTCGCAAAAA
GGTATTTTAATAAATAATTATTGTTAAAAATTTGTATCTTAATAAATAAATATTTTACTA
TGAAACTATTTATTTATCTTTCGAAATATTTTATAAATATTTAGATGAGTTTATGTATGC
CTAAAAGCAGCTAAATTTAAATCTAGGGAATTATTTATATGAGTACTAAAAATAAAAATT
GTATGAATCATGGATAACCAGTGATAAGATATAATAGTTACCTCAAGAAAGGAGAGATAA
AAAAGCTGGAAAGTACCAATAAAACGAGAGTTATAATAGGCAACAATCTGTAAAGAGCCT
TAAAAAATCAATAGCTAAAAGCGCATCCTGTAAATAAATAAATAAATTTGAACATTTTGT
ATTTGTTATTTTGTAATAAAAATATAGATCCATAATATATTGAGTAAATAAATGGTATTT
ATGAAGGAGATTTAGATATGAATTATAAAAAGGAAGGACTAGGAATATTTATTGAAGATC
AAGGTGAGATGTATATTGGTAAAAAAATAACTTAATTTTAAAAATAAAATTGTAAAATTT
AATTCATTTAAAAAATTTTTAGGTGAATGGTCTAACGATTAAATGCACGGTGAAGGCATT
TTGCACTTCCGTTTCGGTGGTTATTTATATGGGAGGTTTAAATAGAATAAGGTTCATGGC
ATTGCAATATTAAATATTCCATTAAAAAACCAATTATTTATTGGTTATTGGAAACAATCT
ACTTTGAATGGTGTTTGCTTTGAACTTAATTTAAATTCTAGATAGTGGTCTCTCTCTATT
TATGAAAATGGAGAGCTAAAGGAAAAATAGCAAACCGAAGCTTTAGAAATGAATTCATCT
GGAATGGGTAAATAAATTTACACAATTTATTTAACAGATTTCTTAAATATAATTTTAAAA
AGTTTACCCTAAGATTATGGACCCTTATGAAGATATAAAATTTTGGATGAGTAGATAGTC
AAACAAGCAATATTTCTTAGAAAGAAATATTAATACTTAGTAAAAGCACATTAAATACAT
AAACATCGATAAAGGAATGGAGTAGGAAGCATTTTTTTAAACAATTTTTTAATTACAAAT
TAATTATAAAGTTATATAGGATTCATTGAAGAAAACAATATCCCAGAGGGATTGGGTCTT
GTTAAATGTGAAAAAGGGTTTATTTATGGATAATTTTGTGTAAAAATATTTCTTGAATTT
TTCAATTAAAATAATAAATAACTTTTTTTATTAAAAAGAATGGCATTTTAGAAGGCTATG
GAAGGATGGTGCTTGATAACGGAGATATTTACGATGGCTATTACAGGAAGGGACAATTGA
ATGGGCAAGGATACTATTTTAATTTTGAAAAAAAGATTTTCATGCATGCTATTTTTGAGG
ATAACATACCAAAGATCTATGAAACAGAGAATAAATATCGTGCTGACTTAATAAGTATGC
TTGCTTTTTTAATATAAATATGAAGTCAAAAATAAAATTATTTTTTACTTTAGAAAAAGA
AAGATCTGAGCAGCATAAGTCTCATAGGAAATTTTATGCGAAAGAGCAGCATTTAGAAAA
ACTTGTTTTTAAAATATTAAAAAACTATGAAGATTTTTATGGAAAGGGTTAATTATAGTT
TGAAAGTGATATAAATAACATGTATTTGTAAAATAGAATAAATAACAGTTTTACAACAAG
AAACTTTATGGATAATAATATTTCTCAATCTCCAAACGTGTAATTTACCTAGATTGCTTC
TCCTACTAGTCAAAGAAGTTTAGATATTACTACAGAAAAATTAGCTGAATCTTTATAACC
TTCATAAATTCCTCAAATTTCTCAAACTATTTAACAGTAAAATGTTATTAATAATTAATC
TCTAAATTAGGTAGCAGCATAAAATCAATAAAATAACCCAAATAATAAAATAATCAATAA
TTAAAGTTAGCAACCAACAAGCTAATTAGCATAACCTTAGATTAACTAAACATAAAATTA
ACAAAAAAGTATATCCTTAAATAATTCTAACAGCATTTAAGGAAATTTAAATAATTAAAA
TTTATTATCAAACAATCAAAATAATACAAGTGGAATTATTTAAAACTAGCAAACAGCATC
ATTTTCTTAATAATAAATATAATAACAATAGTAGTTAAATTAATAGCAGTAGTAATTAAA
TTTATAGCAGTTATAGCAGCAATAATAGCTAAATCAATAATAATTGCAGTTATAAAATCA
ATAGCAGTAATAAGTTAACATGTAGCAGTAATAGTAGCAAAACTAAGTTTAATAGATTAC
TTTAATCTAAAATGAATCTGGCGTTTAATTATCATAATAATCTTTCTCTGAAAATGTTGT
TGATTCACCAGTTAAGATGGAAAATAAAAATGAAGTAAAGTCTAACTTGATAGCAGGTAG
CGTGATTTAAGGTATCAGATAGACTGCTAAACCTTAGAAAAGAGAGTCAAAGTACATTGA
ACCCCCTAGTATTAAAAAACCTCAAGAATTGCAATATAATGCTTCTTAGGAGTAATATGA
AAGGTTTTAAAAAATGTAAGAAACAAGAAAGTAGTATACTGCTCAGCATTAATATTAAAA
TGAAACAGAGTTCAGTTTAGAAGTGGACCCTTCCAAAGATTTATTTTCATTTAAAAAAAT
TAATACAAGCTATATGGAGAGAAGTTAGAAAAGAAGAATATTTGAGGATAACCCTCGTTA
TCAAAAAGAAGTATTTTAATAGTCTCGTTCTATGACTCCTCATAAAGAATTATTGAGAGA
TGATTCTGCTAGGAGTACTTTAAGTTAGTAAAGATATAGAAAAAATGAGTATATGAAAGA
CATAAATACTCAATAGAAAAATAGGAACTAGCAAACCATGTAAAAGGGTATAGTTATAAC
TCATGACGAAGAATAAAAAGTATGGGAAAACGATTTTATAGGAAACAAGGAAGAAAATAT
TGATAATAATGTTGAGCATTTTTGTATTTTAATAAGAGACCAATAAAAGAATGATAAAAA
ACAACAAAATTCTCAACAAAATTAACAATATTAAGGAAATGATTTTAATAACTAAAATGT
AAGGCGTTAAAAAATATTTTAAAATAATGCTTCATAGAAATTTGTTGACGATGATTTCTA
GTAAGAGAATATTTCATCTAGAAACATGATGAGCTCCAAGATAATAGATTAAAAGCTTCA
ATAAAAATTATAGTAAAATAAAGAAAATGGAAAGAAACTTCAAGAAATAGAATATGATAA
TAATAATAGTAATAACAATATTAATATTTATTAAGATTAACTTGATATGTCAGACCAAGA
AAATAAATAATACTTAGAAAAATATGTGTTTTCCTTGGTTGAAAAATTTACTCAAGAAAA
TAATTAAAATTCAAAGCTAAAGCCTATTGAACATCAAAACTTTGAGAAATCGAGAAATGA
AAGTAAATATTTTAAAAATGAATTTAGGCTTAAAGAATAAGATAGTATTATCAAATCTAG
TAATACTCCTTCAAAAGATTAAAAACAAAATAAAAAAAAGATTTTTGATAAAATACAAGA
AATCCACCTAGAAAAAAGCAATATTAAAAGTTTATAACAAGAGAATCAATCAGTAAGAAG
AGATGATGATACCTTTGATTATGCAGATGGACCAAATCTATCTTAAGGCTTACAAAACTC
TCTAAGGGATGTATAAAACTTTTAATAAAGCTATCTTAGAAAAAGCCAAATTCAAAATTT
AAAACCTAATACATAAAGAAGTTAATATGAAAATAATTCATAGTTTTTAGCTACTGATAG
ATAAGATTTTCAATAAAATTCATAGTAATCAACTGGTTACCCTTACAAATCTTAATAATT
TTTTTACAATATGTCACCATAAACTAATAACGATTTCTAATGA