Identifiers and Description

Gene Model Identifier

TTHERM_00144930

Standard Name

MRNN01 (Membrane Occupation and Recognition Nexus protein N-terminal)

Aliases

PreTt26701 | 11.m00398 | 3702.m00120

Description

MORN motif protein

Genome Browser (Macronucleus)

GBrowse

Genome Browser (Micronucleus)

GBrowse

Gene Ontology Annotations

No Data fetched for Gene Ontology Annotations

Domains

Gene Expression Profile

  • Tetrahymena Functional Genomics Database:

Change in Gene Expression

TMHMM

TMHMM

Signal Peptide

Signal Peptide Present?: No
Presense Probability: 9.9%

TetraMine Data

TTHERM_00144930

WebApollo

Fullscreen View

Tetrahymena Stock Center

No Data fetched for StockID

Homologs (v.2006 protein sequences)

SourceIdentifierScoreDescription
Tetrahymena borealisEI9_04770.15.9988120619233335e-177protein kinase domain-containi
ng protein (1224 aa)
OxytrichaContig1226.1.g1110.00000000000001000191320216021MORN repeat

General Information

No Data fetched for General Information

Associated Literature

No Data fetched for Associated Literature

Sequences

>TTHERM_00144930(coding)
ATGAAGCCTTAAACATCTCATAGCTCTGAAAAATTAAAAAAAATTATGTAACCAAAATAC
TAAGTAAACTTACACCAAAAGAGCTAAACTTAAATTTATAATCCATCTAGCTTATAAATT
TAACCTCTGAGCTAAATGCTTAACCTTAATTTAAAAAAATAAATAACAGATAAGCATCAA
GTCAGTTCGAATTACAGCTCTTAGAATTAATTTATGTAAATATTTTAACAGGTCAGTGAA
AACAAAAACTAGAAGATAGACCAAAATAGTATATCTCAACAAAAAAAATATACTTAATTT
ATTAAAAAAAATTACTAAAATGGTATTTACTTTGGGCAAATGAATTGTAACACACCTGAT
GGAGAAGGTGGTTTCTTTTGGGATAATGGTTGCTTTTACTATGGTTAGTGGAAAAATGGA
TTGATGCATGGCTGTGGTCTATTTATTTTTAAGACAGGCAGCGTTTTAAGAGGGAACTTC
AAGAAAGGTTAAGCTAATGGATTAGCAGAGCTCTCTTTTTTTCCATCGTTCTAATAATAG
ATTTTAAATGGTTTTTGGATTGATGGATAGTTTGAAGGCTCATCACCAGCTCAGTTTTAT
AAAAATGGGTTTAATTAAGTAACTAACTTTGATGAAAAAAATTAAAGTGAAGGAAAGAAA
CTGTAAGTTGCTTTTTTTTCAGATAAAATTGAAAGCAAATAGAAAGATAATTCATAAAGT
TAATTCGAAATTAATCCTTATTATTATGATGCTGAGTTAAAAAAAAGACTAGAAAATTAT
ATTGCTTGCGAGAACAGTATAGAAGTTGGTGAAAGAAAAAGTAATTTGCTAAATGGTCTA
GCTATTAGATTCCACTTTGATGGAAAAATTGAATTTGGAAGTTTTAAAAAAGGATTACTT
GAAGGAAGAGGCAAAATAATTTTCAAAACAGGAGACATTTATGATGGATATTTTATTAAT
TCTATATTTTAAGGTCCAGGAGTTTACTATAACAACTAAGATAAGGTGTGGGCTTACGGT
GCATTTTCTAAAAACAAAATAATGTATTTGCAGCAATAAAATACTTCATATCCTCCTCCA
GCTTTATATGACCTACGTGAAAAAGACGAATATGTTGATTCTAGTGATAGATTAATTGGC
GAAAACTAACTTAGAGATAGAAATATTGTCCTGGACACTGTTCTAGTAGAAGATATTCAA
AAAAGGGCTAACGGTGAAGTAATATAACATTAAACTCGTACAAACTAAACAACACAAGCA
GATTAAACTGAAGAAGAATTAGATGCAGGAGTTCGCTAATATTCTTAAATTTCACCATTT
TCAGGTGCTGTAGAATAAAACAAGATGAGTTCTTACTATAATCCAGAGTTTGTAAATTAA
GCAGGTCTAAGAAAAACTGCAGATTTTGGAAACACAATTAAAAATTTATCAAGCATATTT
TAAGCTTCACCAAACAATCTTTAAGAGGATACTATTAATAGAGACTAAGAATTAATAAAT
ACAAGCCACGATAAAGTTAGAAAATCTATTGAAGAAAAGATAATAGAAAAGCAACTTGAG
AGTGATAATGAAGCCAATAATTAAAATTCAAATTAGTCACATCCTTCTTAATAACTAGAA
ACTCATCAAACAGTCATTTAATTTTCTCCAAAAAGCTAAAACTATTTAACTTCAAGAAAC
AAAACAGCTAATAATTTGGAAAATAATTTAACTCATGATAACCTTGAATTCCCATGTGAA
TTCACTCAAAAATATTATTATGGTATAAGTGAAGAGACATATTAAATCATTTAAGAACTT
GAAAAGAAAGAAATTATTTAGAAAAAACGAGAAAAATCTTTAGAAAAAATTAGCTAAATA
AAGGCTTTGATTACAAATTATTTGAGTTAACCATAAAATTTATTGGTTTCTACACCGAAT
AACAAAAAATCTTTATAAAGAAATTAATAAACAAATATTGATAAATAAAACTCTCTGAAT
AAAACAACTACAAGAAGTAATAATGAAAATATAAATCCTTAAATTAAAAGAAATCCTAGC
TCTGTATCTTCTTATTCTACTCGAAATTAGTTTTCTGGAGTTCTAAGTAGTTAAAAACCT
AAAAGTAACTATTAAAATAGAGAATAACCAAGAAAAATTTAAACTTTTGAAGATTAAAGT
ATTTCAAGCAGAAATATGCAAGGAAAGAATAATTCAATTAAAAATAATAATCATGTTTAG
ATCCAAAATGAAATCACAAGTAGATAAAATTCCTAAAAAGTGAACAATAACTTCATTGGA
AATCAAACTTTTTAGAATATTTATAAAAATAATGAACTATTTTAACCCTTTCAAATTTAA
GATATAAATAATACATAAAATAAATGTAGCTTCAATGAAAAATAGAAACATAATTTTTAA
GCTAATCCTGAAAAATAAAATAGAGTTTCTATAAATTCTTCTAAATCAAATTCACAAGTT
TAGTAGAGCTCTCCAAACTAGTTTAAAAAAATTTAGTAAAGGATAAAAAACTTTTCTCAG
TAATATGAAGCATAAAATTAAATAAATTATCAACAAGGCAATAAGAATAAGTAGAATATT
ATTTTTAAGAATTTTGAGCATATACAAAGTGAAAATACTCCTATATCCTCTCCACATAAT
TATTAGGCAAATTTAAATCCTTAGAATTAACAAAGTACCAAAAACAATCATCCTAATGAA
CCCTAAAAATAGTTTTTCTTTACATAATCATGCCGTAATCATAAAAGACATGTCTCTTCT
ATTAGCTTTAGCTCTAATAATTAAGTAGGAAATACCTAAATATAACCAAAAAGATCTCAA
TATCCGTTAAGTATTTAAATATACTGA


>TTHERM_00144930(protein)
MKPQTSHSSEKLKKIMQPKYQVNLHQKSQTQIYNPSSLQIQPLSQMLNLNLKKQITDKHQ
VSSNYSSQNQFMQIFQQVSENKNQKIDQNSISQQKKYTQFIKKNYQNGIYFGQMNCNTPD
GEGGFFWDNGCFYYGQWKNGLMHGCGLFIFKTGSVLRGNFKKGQANGLAELSFFPSFQQQ
ILNGFWIDGQFEGSSPAQFYKNGFNQVTNFDEKNQSEGKKLQVAFFSDKIESKQKDNSQS
QFEINPYYYDAELKKRLENYIACENSIEVGERKSNLLNGLAIRFHFDGKIEFGSFKKGLL
EGRGKIIFKTGDIYDGYFINSIFQGPGVYYNNQDKVWAYGAFSKNKIMYLQQQNTSYPPP
ALYDLREKDEYVDSSDRLIGENQLRDRNIVLDTVLVEDIQKRANGEVIQHQTRTNQTTQA
DQTEEELDAGVRQYSQISPFSGAVEQNKMSSYYNPEFVNQAGLRKTADFGNTIKNLSSIF
QASPNNLQEDTINRDQELINTSHDKVRKSIEEKIIEKQLESDNEANNQNSNQSHPSQQLE
THQTVIQFSPKSQNYLTSRNKTANNLENNLTHDNLEFPCEFTQKYYYGISEETYQIIQEL
EKKEIIQKKREKSLEKISQIKALITNYLSQPQNLLVSTPNNKKSLQRNQQTNIDKQNSLN
KTTTRSNNENINPQIKRNPSSVSSYSTRNQFSGVLSSQKPKSNYQNREQPRKIQTFEDQS
ISSRNMQGKNNSIKNNNHVQIQNEITSRQNSQKVNNNFIGNQTFQNIYKNNELFQPFQIQ
DINNTQNKCSFNEKQKHNFQANPEKQNRVSINSSKSNSQVQQSSPNQFKKIQQRIKNFSQ
QYEAQNQINYQQGNKNKQNIIFKNFEHIQSENTPISSPHNYQANLNPQNQQSTKNNHPNE
PQKQFFFTQSCRNHKRHVSSISFSSNNQVGNTQIQPKRSQYPLSIQIY


>TTHERM_00144930(gene)
ATGAAGCCTTAAACATCTCATAGCTCTGAAAAATTAAAAAAAATTATGTAACCAAAATAC
TAAGTAAACTTACACCAAAAGAGCTAAACTTAAATTTGTAATTTTACATACTACATTAGT
AAATTTTAGAGTAATAAATAATTAACGATATAAAAATAGATAATCCATCTAGCTTATAAA
TTTAACCTCTGAGCTAAATGCTTAACCTTAATTTAAAAAAATAAATAACAGATAAGCATC
AAGTCAGTTCGAATTACAGCTCTTAGAATTAATTTATGTAAATATTTTAACAGGTCAGTG
AAAACAAAAACTAGAAGATAGACCAAAATAGTATATCTCAACAAAAAAAATATACTTAAT
TTATTAAAAAAAATTACTAAAATGGTATTTACTTTGGGCAAATGAATTGTAACACACCTG
ATGGAGTATATTAATTTATATATTTTATCTTTTATCGTCAATGATCTTTTAATTTATGTA
GGAAGGTGGTTTCTTTTGGGATAATGGTTGCTTTTACTATGGTATATAAAAATATTTTAA
ATAACTAAGTATATAAAAAATAAACACTCATTCATTTAAAATAGGTTAGTGGAAAAATGG
ATTGATGCATGGCTGTGGTCTATTTATTTTTAAGACAGGCAGCGTTTTAAGAGGGAACTT
CAAGAAAGGTTAAGCTAATGGATTAGCAGAGCTCTCTTTTTTTCCATCGTTCTAATAATA
GATTTTAAATGGTTTTTGGATTGATGGATAGTTTGAAGGCTCATCACCAGCTCAGTTTTA
TAAAAATGGGTTTAATTAAGTAACTAACTTTGATGAAAAAAATTAAAGTGAAGGAAAGAA
ACTGTAAGTTGCTTTTTTTTCAGATAAAATTGAAAGCAAATAGAAAGATAATTCATAAAG
TTAATTCGAAATTAATCCTTATTATTATGTAATTAATATTTCAAAAAAGGATTACTCTTT
TTTTAACAAAAATCTATTTATAAAAAGGATGCTGAGTTAAAAAAAAGACTAGAAAATTAT
ATTGCTTGCGAGAACAGTATAGAAGTTGGTGAAAGAAAAAGTAATTTGCTAAATGGTCTA
GCTATTAGATTCCACTTTGATGGAAAAATTGAATTTGGAAGTTTTAAAGTAGGTTTTTTT
GATATTAATTTTATTTTAAATAAAAGAATTTTTCTATTTAATTAGAAAGGATTACTTGAA
GGAAGAGGCAAAATAATTTTCAAAACAGGAGACATTTATGATGGATATTTTATTAATTCT
ATATTTTAAGGTCCAGGTATGAAATATTATTATTTTATGCTCTATCTATATTTATTCTTT
GTGAATATTAAATAGGAGTTTACTATAACAACTAAGATAAGGTGTGGGCTTACGGTGCAT
TTTCTAAAAACAAAATAATGTATTTGCAGCAATAAAATACTTCATATCCTCCTCCAGCTT
TATGTAAAATATTACATATTAATTCGTATATTAAATTCTGATTTCTAACAAAAGATGACC
TACGTGAAAAAGACGAATATGTTGATTCTAGTGATAGATTAATTGGCGAAAACTAACTTA
GAGATAGAAATATTGTCCTGGACACTGTTCTAGTAGAAGATATTCAAAAAAGGGCTAACG
GTGAAGTAATATAACATTAAACTCGTACAAACTAAACAACACAAGCAGATTAAACTGAAG
AAGAATTAGATGCAGGAGTTCGCTAATATTCTTAAATTTCACCATTTTCAGGTGCTGTAG
AATAAAACAAGATGAGTTCTTACTATAATCCAGAGTTTGTAAATTAAGCAGGTCTAAGAA
AAACTGCAGATTTTGGAAACACAATTAAAAATTTATCAAGCATATTTTAAGCTTCACCAA
ACAATCTTTAAGAGGATACTATTAATAGAGACTAAGAATTAATAAATACAAGCCACGATA
AAGTTAGAAAATCTATTGAAGAAAAGATAATAGAAAAGCAACTTGAGAGTGATAATGAAG
CCAATAATTAAAATTCAAATTAGTCACATCCTTCTTAATAACTAGAAACTCATCAAACAG
TCATTTAATTTTCTCCAAAAAGCTAAAACTATTTAACTTCAAGAAACAAAACAGCTAATA
ATTTGGAAAATAATTTAACTCATGATAACCTTGAATTCCCATGTGAATTCACTCAAAAAT
ATTATTATGGTATAAGTGAAGAGACATATTAAATCATTTAAGAACTTGAAAAGAAAGAAA
TTATTTAGAAAAAACGAGAAGTAAAAATTTATTTTTTCATTTTTAATTTTTATTTTTGAA
TTTGTCTTTCTTTCATTATTTGTATTTTATTAAGTTTAAAGAAAAAAGAAATTATTATTT
TAAAATATTTTTGAAAATTTGAAATAGAAATCTTTAGAAAAAATTAGCTAAATAAAGGCT
TTGATTACAAATTATTTGAGTTAACCATAAAATTTATTGGTTTCTACACCGAATAACAAA
AAATCTTTATAAAGAAATTAATAAACAAATATTGATAAATAAAACTCTCTGAATAAAACA
ACTACAAGAAGTAATAATGAAAATATAAATCCTTAAATTAAAAGAAATCCTAGCTCTGTA
TCTTCTTATTCTACTCGAAATTAGTTTTCTGGAGTTCTAAGTAGTTAAAAACCTAAAAGT
AACTATTAAAATAGAGAATAACCAAGAAAAATTTAAACTTTTGAAGATTAAAGTATTTCA
AGCAGAAATATGCAAGGAAAGAATAATTCAATTAAAAATAATAATCATGTTTAGATCCAA
AATGAAATCACAAGTAGATAAAATTCCTAAAAAGTGAACAATAACTTCATTGGAAATCAA
ACTTTTTAGAATATTTATAAAAATAATGAACTATTTTAACCCTTTCAAATTTAAGATATA
AATAATACATAAAATAAATGTAGCTTCAATGAAAAATAGAAACATAATTTTTAAGCTAAT
CCTGAAAAATAAAATAGAGTTTCTATAAATTCTTCTAAATCAAATTCACAAGTTTAGTAG
AGCTCTCCAAACTAGTTTAAAAAAATTTAGTAAAGGATAAAAAACTTTTCTCAGTAATAT
GAAGCATAAAATTAAATAAATTATCAACAAGGCAATAAGAATAAGTAGAATATTATTTTT
AAGAATTTTGAGCATATACAAAGTGAAAATACTCCTATATCCTCTCCACATAATTATTAG
GCAAATTTAAATCCTTAGAATTAACAAAGTACCAAAAACAATCATCCTAATGAACCCTAA
AAATAGTTTTTCTTTACATAATCGTAAGTGATTTTAATTTTTAATTTTATTCAAAGTAAA
ATTTATGAGAATTAAATTTTATTGATGTAAGGTTTATTAGTAGACTAATAAGCCAACATT
AAACATTTAGCATTCCAAGCAGTATAAATAATTCAAAATATTTAAAATTATTTTCAGAAA
TAAATATTTTTGAAACCACATTTAAACTTTATTATTTGATTCTAAAATTTATTTTATTAT
TTATTAAAAAAGATGCCGTAATCATAAAAGACATGTCTCTTCTATTAGCTTTAGCTCTAA
TAATTAAGTAGGAAATACCTAAATATAACCAAAAAGATCTCAATATCCGTTAAGTATTTA
AATATACTGA