Identifiers and Description

Gene Model Identifier

TTHERM_00564551

Standard Name

MRNC55 (Membrane Occupation and Recognition Nexus protein C-terminal)

Aliases

3721.m00737

Description

protein with predicted MORN domains localized at the C-terminus of the protein

Genome Browser (Macronucleus)

GBrowse

Genome Browser (Micronucleus)

GBrowse

Gene Ontology Annotations

No Data fetched for Gene Ontology Annotations

Domains

Gene Expression Profile

  • Tetrahymena Functional Genomics Database:

TetraMine Data

TTHERM_00564551

WebApollo

Fullscreen View

Tetrahymena Stock Center

No Data fetched for StockID

Homologs (v.2006 protein sequences)

SourceIdentifierScoreDescription
Tetrahymena borealisEI9_41194.19.997093137033517e-262hypothetical protein (528 aa)
OxytrichaContig6341.0.g264.999133404870476e-103MORN repeat
Stentor CoeruleusSteCoe_223885.900090541597061e-29
DictyBaseDDB_G03494886.997351175151406e-18DDB_G0349488 on chromosome: 2
position 6912714 to 6914186
WormBaseWBGene000021790.00000000039982266684865623locus:jph-1 status:Confirmed
UniProt:Q22667 protein_id
:CAA99924.2

General Information

No Data fetched for General Information

Associated Literature

No Data fetched for Associated Literature

Sequences

>TTHERM_00564551(protein)
MNSNQSSPEHSLTKRNSRVASTQELHMPIKDWISHLANLEDQDQILEYFETYKPQSNTFD
MNELKNNSNLRIKRYKNCIYYGIILEGLREGKGILCYYNGRIYEGEWKNDKKHGKATEIY
QNGGRYFGNFANGKKNGKGQFKWVNGEIYDGEWKDGTKHGSGLWKGIKGDSYIGEWKEGK
TDGFGVHTWINGDRYEGEFKQCLKHGLGTERFANGDVYIGNYEYGKPEGYGEYYWSVGNF
YKGYFVNGLRHGRGIWKAVKDGGDCYEGEYRNDKKCGYGEYKWGTGNIYKGNFENDLRHG
YGEMYWKDGSVYRGYWMNGLQVGEIKEDLNENNSSRLVDEQMDNQQMQHQREGDDYLNIP
PDKQKSSATLTDNQSYKSPIQKSQNTTQLTLPKINGSQYGSNYSGNKPKRLISLSPEKQS
QKVLPKLECQTCANKRICSASNHNMIPQRNASLSYKRNNNGNLSSRRKDLSIDQISTNYQ
SPRDNSNSRSNSSSRKAIWRPSGVAQHFNPVGFDLNAKNHIQSKYNRL


>TTHERM_00564551(coding)
ATGAATAGCAATCAATCATCTCCCGAACATTCACTAACAAAGCGAAATAGCAGGGTCGCT
TCTACTTAGGAGTTACACATGCCCATCAAAGATTGGATTTCACATTTAGCTAATTTAGAA
GATTAGGATTAAATTCTTGAATATTTCGAAACATATAAACCTCAATCCAATACTTTTGAT
ATGAACGAGCTCAAAAATAACTCTAATTTAAGAATTAAAAGATATAAAAATTGCATTTAT
TATGGCATTATACTTGAAGGATTAAGAGAAGGCAAAGGTATATTATGTTATTACAATGGA
AGAATATATGAAGGTGAATGGAAAAATGATAAAAAACATGGAAAAGCTACAGAAATTTAT
TAAAACGGTGGAAGATACTTTGGAAACTTTGCAAATGGGAAAAAAAATGGCAAAGGATAA
TTTAAATGGGTAAATGGTGAGATATATGATGGAGAATGGAAAGACGGTACTAAGCATGGA
TCAGGATTATGGAAAGGAATTAAAGGTGATTCTTATATTGGAGAATGGAAAGAAGGAAAA
ACAGATGGATTTGGTGTACATACCTGGATTAATGGTGATAGATATGAGGGAGAATTCAAA
TAATGTTTGAAACATGGTTTAGGAACTGAAAGGTTTGCAAACGGAGATGTATATATAGGA
AACTATGAATATGGAAAACCTGAAGGATATGGAGAGTATTATTGGAGTGTTGGAAACTTT
TATAAAGGTTATTTTGTTAATGGTCTAAGACACGGTAGGGGTATTTGGAAAGCTGTAAAA
GACGGTGGTGATTGCTACGAAGGAGAATATAGAAATGATAAAAAGTGTGGGTACGGCGAG
TATAAATGGGGAACTGGTAATATTTATAAAGGGAACTTTGAAAATGATCTAAGACATGGA
TACGGTGAAATGTATTGGAAGGATGGTTCAGTGTACAGAGGCTATTGGATGAATGGTCTG
TAAGTAGGAGAAATTAAAGAAGATTTAAATGAAAATAATTCAAGCAGACTTGTAGACGAG
TAAATGGACAATTAATAAATGCAACATTAAAGAGAAGGCGATGATTATTTGAATATACCA
CCTGATAAATAAAAAAGTAGTGCTACTTTAACAGATAATTAAAGTTATAAGTCACCAATA
CAAAAATCCTAAAATACAACTCAATTAACACTCCCAAAAATAAATGGGTCATAATATGGT
AGCAACTATAGTGGAAATAAACCTAAAAGATTGATATCACTCAGTCCTGAAAAATAATCA
TAAAAAGTATTACCTAAATTGGAGTGTTAAACTTGTGCTAATAAGAGAATTTGCTCTGCC
TCTAACCACAACATGATACCCTAAAGAAATGCATCTCTCTCGTATAAAAGAAATAATAAT
GGTAACCTATCAAGTAGAAGAAAGGATTTAAGTATAGATTAAATTTCCACAAACTATTAG
AGTCCTAGGGACAATAGTAATAGTAGAAGTAATTCAAGTAGTCGTAAAGCTATATGGAGA
CCTTCTGGAGTAGCTCAGCACTTCAATCCTGTAGGATTTGATTTAAACGCTAAAAATCAC
ATTTAAAGTAAATATAACAGGCTTTGA


>TTHERM_00564551(gene)
ATGAATAGCAATCAATCATCTCCCGAACATTCACTAACAAAGCGAAATAGCAGGGTCGCT
TCTACTTAGGAGTTACACATGCCCATCAAAGATTGGATTTCACATTTAGCTAATTTAGAA
GATTAGGATTAAATTCTTGAATATTTCGAAACATATAAACCTCAATCCAATACTTTTGAT
ATGAACGAGCTCAAAAATAACTCTAATTTAAGAATTAAAAGATATAAAAATTGCATTTAT
TATGGCATTATACTTGAAGGATTAAGAGAAGGCAAAGGTAAAATATCATTTTAAATTAAA
AGTATAAATTGTTTTTATGTAATTTTGATTAAAAAGGTATATTATGTTATTACAATGGAA
GAATATATGAAGGTGAATGGAAAAATGATAAAAAACATGGAAAAGCTACAGAAATTTATT
AAAACGGTGGAAGATACTTTGGAAACTTTGCAAATGGGAAAAAAAATGGCAAAGGATAAT
TTAAATGGGTAATTAATTCTAAGAATTAATTAATGAGAAATTAAACTCATTTTTATTTCT
TATAAATAATTTTGAGTTTTAAAATAAAATGAAAGTAACTTTATTCGTATTTAATAAAAG
GTAAATGGTGAGATATATGATGGAGAATGGAAAGACGGTACTAAGCATGGATCAGGATTA
TGGAAAGGAATTAAAGGTAAAAAATAGATTTATTTCATGATTGTGGATTATGTTTATTTA
ATAATGTCAATAAAATAAGGTGATTCTTATATTGGAGAATGGAAAGAAGGAAAAACAGAT
GGATTTGGTGTACATACCTGGATTAATGGTAGTTTTATATTTTATTATGTACATTAATAA
ATAATTTTCTTAAAAAGGTGATAGATATGAGGGAGAATTCAAATAATGTTTGAAACATGG
TTTAGGAACTGAAAGGTTTGCAAACGGAGATGTATATATAGGAAACTATGAATATGGAAA
ACCTGAAGGATATGGTAATATTTTATTTTAGATTTTTTAGCTTGGGGATTAAAGTTATCT
TATTTTTATAGGAGAGTATTATTGGAGTGTTGGAAACTTTTATAAAGGTTATTTTGTTAA
TGGTCTAAGACACGGTAGGGGTATTTGGAAAGCTGTAAAAGACGGTGGTGATTGCTACGA
AGGAGAATATAGAAATGATAAAAAGTGTGGGTACGGCGAGTATAAATGGGGAACTGGTAA
TATTTATAAAGGGAACTTTGAAAATGATCTAAGACATGGATACGGTGAAATGTATTGGAA
GGATGGTTCAGTGTACAGAGGTAAATAATAGATATTTTTTTGAAAAATTTGATTTGAAGA
TGAATAAATAATTTGTTAAAATTTAGGCTATTGGATGAATGGTCTGTAAGTAGGAGAAAT
TAAAGAAGATTTAAATGAAAATAATTCAAGCAGACTTGTAGACGAGTAAATGGACAATTA
ATAAATGCAACATTAAAGAGAAGGCGATGATTATTTGAATATACCACCTGATAAATAAAA
AAGTAGTGCTACTTTAACAGATAATTAAAGTTATAAGTCACCAATACAAAAATCCTAAAA
TACAACTCAATTAACACTCCCAAAAATAAATGGGTCATAATATGGTAGCAACTATAGTGG
AAATAAACCTAAAAGATTGATATCACTCAGTCCTGAAAAATAATCATAAAAAGTATTACC
TAAATTGGAGTGTTAAACTTGTGCTAATAAGAGAATTTGCTCTGCCTCTAACCACAACAT
GATACCCTAAAGAAATGCATCTCTCTCGTATAAAAGAAATAATAATGGTAACCTATCAAG
TAGAAGAAAGGATTTAAGTATAGATTAAATTTCCACAAACTATTAGAGTCCTAGGGACAA
TAGTAATAGTAGAAGTAATTCAAGTAGTCGTAAAGCTATATGGAGACCTTCTGGAGTAGC
TCAGCACTTCAATCCTGTAGGATTTGATTTAAACGCTAAAAATCACATTTAAAGTAAATA
TAACAGGCTTTGA