Identifiers and Description

Gene Model Identifier

TTHERM_00940320

Standard Name

MRNC54 (Membrane Occupation and Recognition Nexus protein C-terminal)

Aliases

PreTt25138 | 171.m00047

Description

protein with predicted MORN domains localized at the C-terminus of the protein

Genome Browser (Macronucleus)

GBrowse

Genome Browser (Micronucleus)

GBrowse

Gene Ontology Annotations

No Data fetched for Gene Ontology Annotations

Domains

  • ( PF02493 ) MORN repeat
  • ( PF06991 ) Micro-fibrillar-associated protein 1 C-terminus

Gene Expression Profile

  • Tetrahymena Functional Genomics Database:

TetraMine Data

TTHERM_00940320

WebApollo

Fullscreen View

Tetrahymena Stock Center

No Data fetched for StockID

Homologs (v.2006 protein sequences)

SourceIdentifierScoreDescription
Tetrahymena borealisEI9_19581.19.997093137033517e-262hypothetical protein (854 aa)
OxytrichaContig13677.0.1.g353.999031314999233e-77MORN repeat
Stentor CoeruleusSteCoe_83979.854154686111257e-34
WormBaseWBGene000021790.000000000000004001928599951003locus:jph-1 status:Confirmed
UniProt:Q22667 protein_id
:CAA99924.2
DictyBaseDDB_G03494880.0000000000002999981760818895DDB_G0349488 on chromosome: 2
position 6912714 to 6914186

General Information

No Data fetched for General Information

Associated Literature

No Data fetched for Associated Literature

Sequences

>TTHERM_00940320(coding)
ATGAGAAAAGCTAATACATTGTCATCAAACTCTATTTCATATAATCGCACAATGAACAAT
AATAATAATAATGGAAGTTACTCAAATAACAATGGAAATTCTCAAAATTCGAATCATCTT
CTTTAAGTAGATAATGAATTTAAATGCAATATTAAGGATCATTAGCGTGAAAGAATAGAT
TATATTTGCACATATAAAGATTGTACAGCAGAGAGTCGTTTATGCTGCATGTATTGCAAA
TAACTTTATCACGGAAGCCATTAAAAGGAGAAAGTTATTAAACTTAAGGAATTTTCGTCA
AAGGTGGTTGTTGATGCTGAGAAATTGACAAAGCGTTTTGAAGAAATGGTGGAAGAAAAT
GACATTAAATTGATATTTTAGTAAAGGTTACAAAAAACTGTGAAAGATAAGCTGAATGAA
TTAGTGAAATCTTTTTAAAGATCTATAAAAATATCTAGGGAGAGAATATCAACTATTATT
GAATCAACTTAAAATATCTACGAGTAAGCAGAAAATTAAGATATTTGCGATGATATTCAT
GAGTTTAATAATGAATTATATAAAATTCTTCACCGTAGTTATAAACTGCATTCTAAAGAG
GATATTGAAATTTTAACAAAAATTTACAGAAATGAGAATTATAGCGAGTATTTATCTAAT
TCAAAATCTATATCTAGGAACAAATTCTTTTATTTTGCAAATGATAGATTGGATTAATAT
TTTAGCTAGTTAACTATTGAAACTGATAATTTAATTAGAGATTTAGGAGGATAAATTAAA
AAAATGGAAGAAATTGTAGCCTAAAGTTTAGGGGAATAACAAAATAAAAATTAAGGTTAG
ACCACTAAACTACCTACTATAGGACGTAATTCTTCAGAAACAAGGTTTAACCAAAAAAAT
GTTCCTAACTATGCAAGACCTCGCTCATCAGATAAAAATAAATCATAAATATTGATAACG
GATCCTTCAGGTTATTAAAATGAAAGATCAGCTCCTAACAAGCAGTACATGCTAAAAAGA
GAAGTTCTTAATCCTAATAATAACTCCTTTAATGGAAGAAGTTTGCTTAATTCAATGAAT
TAATCCAACAATAATCACTACCCAGTCATGCAAAGAAATACTAAAAGTTATAAAACAGTA
AAGTTTGATAAAAACTAAATAGGGAATAATGGCTCTAAATTTAATCTAAACGACTGCATT
CTTCTTCTTGATTTGGAAAATAACAATAAAAAAAGAGGTAATAACTAGAGATTGAGCCAA
TCTAACCTAAATGATTCACTTCTTTCTTAAGATAACCATGAATCAAATATGCCTTTTAGT
CCTTTTAAAGATTCTAATTCTAAAAATAATGGAAGTTTCTCACTTCTAAAGGATCTTATG
TATGTTGATAATCCTCCTTAAAATAATACAGGCAGCTAAATTAAAAATTAAGACAGCAAT
TAGAAACAAAATGGTAGCAATGTTAAAGAAGCAACCTCTCCAGAATCTTAAATAGCATAT
AATAATTAAAAGTAAGAGGCTGATAAAAAGTAACAAGGAGAATCTGCAACGAAAGCTGAA
AATAATTAAAAAGAGAATTAACAATTAAATCAACAAGGCTCTTTACCTGTATATAAAATA
AGAGATATTTAAAAAGAAAACTAAGAAAGAAATAAGCCAAAAGAGGAGTGGATTTAAATA
AATGAAGAAGAAGTACCAGATATTAAAAGCTTAACTGAAGCTGCAGATAAGTAAATAGGA
GAATTTTAATACATACTTCCTACTGATCATACAGATTCTGAGTACTCTACACTACCTGTC
ATGAAAAACACTACTAATGGCTAAATCTACAGTGGATAATGGAAAGATGGCTAAAGACAT
GGAAAAGGTTTAGGGATTTTAAAAGATGGAAGTGTCTATGTAGGTTACTGGAAAAATAAC
TAAGCTAATGGATATGGAAGAATTATTCATCCTAATGGCAATATATATGAAGGTGATTGG
ATGAATGGCAAAGCTCATGGAAGAGGTATTTATAGGTATCCAAACGGAACTAAATACGAA
GGAGAATGGTTTGAAGATTTGTATGATGGGTATGGTGTAAAAACATGGAATTAAGGTAGT
GTTTACTAAGGTTACTATCGTTAAGGTTACAGAGACGGAAAAGGGGTCTTTACATGGCCT
GATGGAAGCAGCTATGATGGGTATTTTTATAAAAATCAAATTCATGGTTATGGCATCTAT
AAATGGAAAGATGGAAGAGAATATAGAGGTGAATGGTCTAGTGGAAAGATGAATGGAAAA
GGCTGGTTCAAGTGGCCTGATGATAGAATTTACGAAGGAAACTATTTTAATGACAAAAAA
GAAGGATTTGGAGTATTCCATTGGCCTAACAACGAAAAAACATATGAAGGATATTGGTTG
AATGACTAACCTCATGGCATAGGACATATAATACAAAAAAATGGATAAAAGTCAAAGGGA
GAATGGTAAGACGGAAAACAAATTAGGTGGATACCAGATTCTGAAGATACATCAGCACAA
GAAAAAAAACTTTAACTTTAATTTTCAAAACCTGGTTCAACCAAATGA


>TTHERM_00940320(protein)
MRKANTLSSNSISYNRTMNNNNNNGSYSNNNGNSQNSNHLLQVDNEFKCNIKDHQRERID
YICTYKDCTAESRLCCMYCKQLYHGSHQKEKVIKLKEFSSKVVVDAEKLTKRFEEMVEEN
DIKLIFQQRLQKTVKDKLNELVKSFQRSIKISRERISTIIESTQNIYEQAENQDICDDIH
EFNNELYKILHRSYKLHSKEDIEILTKIYRNENYSEYLSNSKSISRNKFFYFANDRLDQY
FSQLTIETDNLIRDLGGQIKKMEEIVAQSLGEQQNKNQGQTTKLPTIGRNSSETRFNQKN
VPNYARPRSSDKNKSQILITDPSGYQNERSAPNKQYMLKREVLNPNNNSFNGRSLLNSMN
QSNNNHYPVMQRNTKSYKTVKFDKNQIGNNGSKFNLNDCILLLDLENNNKKRGNNQRLSQ
SNLNDSLLSQDNHESNMPFSPFKDSNSKNNGSFSLLKDLMYVDNPPQNNTGSQIKNQDSN
QKQNGSNVKEATSPESQIAYNNQKQEADKKQQGESATKAENNQKENQQLNQQGSLPVYKI
RDIQKENQERNKPKEEWIQINEEEVPDIKSLTEAADKQIGEFQYILPTDHTDSEYSTLPV
MKNTTNGQIYSGQWKDGQRHGKGLGILKDGSVYVGYWKNNQANGYGRIIHPNGNIYEGDW
MNGKAHGRGIYRYPNGTKYEGEWFEDLYDGYGVKTWNQGSVYQGYYRQGYRDGKGVFTWP
DGSSYDGYFYKNQIHGYGIYKWKDGREYRGEWSSGKMNGKGWFKWPDDRIYEGNYFNDKK
EGFGVFHWPNNEKTYEGYWLNDQPHGIGHIIQKNGQKSKGEWQDGKQIRWIPDSEDTSAQ
EKKLQLQFSKPGSTK


>TTHERM_00940320(gene)
ATGAGAAAAGCTAATACATTGTCATCAAACTCTATTTCATATAATCGCACAATGAACAAT
AATAATAATAATGGAAGTTACTCAAATAACAATGGAAATTCTCAAAATTCGAATCATCTT
CTTTAAGTAGATAATGAATTTAAATGCAATATTAAGGATCATTAGCGTGAAAGAATAGAT
TATATTTGCACATATAAAGATTGTACAGCAGAGAGTCGTTTATGCTGCATGTATTGCAAA
TAACTTTATCACGGAAGCCATTAAAAGGAGAAAGTTATTAAACTTAAGGAATTTTCGTCA
AAGGTGGTTGTTGATGCTGAGAAATTGACAAAGCGTTTTGAAGAAATGGTGGAAGAAAAT
GACATTAAATTGATATTTTAGTAAAGGTTACAAAAAACTGTGAAAGATAAGCTGAATGAA
TTAGTGAAATCTTTTTAAAGATCTATAAAAATATCTAGGGAGAGAATATCAACTATTATT
GAATCAACTTAAAATATCTACGAGTAAGCAGAAAATTAAGATATTTGCGATGATATTCAT
GAGTTTAATAATGAATTATATAAAATTCTTCACCGTAGTTATAAACTGCATTCTAAAGAG
GATATTGAAATTTTAACAAAAATTTACAGAAATGAGAATTATAGCGAGTATTTATCTAAT
TCAAAATCTATATCTAGGAACAAATTCTTTTATTTTGCAAATGATAGATTGGATTAATAT
TTTAGCTAGTTAACTATTGAAACTGATAATTTAATTAGAGATTTAGGAGGATAAATTAAA
AAAATGGAAGAAATTGTAGCCTAAAGTTTAGGGGAATAACAAAATAAAAATTAAGGTTAG
ACCACTAAACTACCTACTATAGGACGTAATTCTTCAGAAACAAGGTTTAACCAAAAAAAT
GTTCCTAACTATGCAAGACCTCGCTCATCAGATAAAAATAAATCATAAATATTGATAACG
GATCCTTCAGGTTATTAAAATGAAAGATCAGCTCCTAACAAGCAGTACATGCTAAAAAGA
GAAGTTCTTAATCCTAATAATAACTCCTTTAATGGAAGAAGTTTGCTTAATTCAATGAAT
TAATCCAACAATAATCACTACCCAGTCATGCAAAGAAATACTAAAAGTTATAAAACAGTA
AAGTTTGATAAAAACTAAATAGGGAATAATGGCTCTAAATTTAATCTAAACGACTGCATT
CTTCTTCTTGATTTGGAAAATAACAATAAAAAAAGAGGTAATAACTAGAGATTGAGCCAA
TCTAACCTAAATGATTCACTTCTTTCTTAAGATAACCATGAATCAAATATGCCTTTTAGT
CCTTTTAAAGATTCTAATTCTAAAAATAATGGAAGTTTCTCACTTCTAAAGGATCTTATG
TATGTTGATAATCCTCCTTAAAATAATACAGGCAGCTAAATTAAAAATTAAGACAGCAAT
TAGAAACAAAATGGTAGCAATGTTAAAGAAGCAACCTCTCCAGAATCTTAAATAGCATAT
AATAATTAAAAGTAAGAGGCTGATAAAAAGTAACAAGGAGAATCTGCAACGAAAGCTGAA
AATAATTAAAAAGAGAATTAACAATTAAATCAACAAGGCTCTTTACCTGTATATAAAATA
AGAGATATTTAAAAAGAAAACTAAGAAAGAAATAAGCCAAAAGAGGAGTGGATTTAAATA
AATGAAGAAGAAGTACCAGATATTAAAAGCTTAACTGAAGCTGCAGATAAGTAAATAGGA
GAATTTTAATACATACTTCCTACTGATCATACAGATTCTGAGTACTCTACACTACCTGTC
ATGAAAAACACTACTAATGGCTAAATCTACAGTGGATAATGGAAAGATGGCTAAAGACAT
GGAAAAGGTTTAGGGATTTTAAAAGATGGAAGTGTCTATGTAGGTTACTGGAAAAATAAC
TAAGCTAATGGATATGGAAGAATTATTCATCCTAATGGCAATATGTAAATAATAAATTTA
AACGTTATTTAAAATTTTTTTAAATTAAATTAAAAATATTTTTATTAATTGGTATTTTTT
GCTTTTTTAAATAGATATGAAGGTGATTGGATGAATGGCAAAGCTCATGGAAGAGGTATT
TATAGGTATCCAAACGGAACTAAATACGAAGGAGAATGGTTTGAAGATTTGTATGATGGG
TATGGTGTAAAAACATGGAATTAAGGTAGTGTTTACTAAGGTTACTATCGTTAAGGTAAA
TATTTACTAAAATTTTAATTAATTTAAAAATAAATGGTCAAAATTAAAAATAAAAAAGGT
TACAGAGACGGAAAAGGGGTCTTTACATGGCCTGATGGAAGCAGCTATGATGGGTATTTT
TATAAAAATCAAATTCATGGTTATGGCATCTATAAATGGAAAGATGGAAGAGAATATAGA
GGTGAATGGTCTAGTGGAAAGATGAATGGAAAAGGCTGGTTCAAGTGGCCTGATGATAGA
ATTTACGAAGGAAACTATTTTAATGACAAAAAAGAAGGATTTGGAGTATTCCATTGGCCT
AACAACGAAAAAACATATGAAGGATATTGGTTGAATGACTAACCTCATGGCATAGGACAT
ATAATACAAAAAAATGGATAAAAGTCAAAGGGAGAATGGTAAGACGGAAAACAAATTAGG
TGGATACCAGATTCTGAAGATACATCAGCACAAGAAAAAAAACTTTAACTTTAATTTTCA
AAACCTGGTTCAACCAAATGA