Identifiers and Description

Gene Model Identifier

TTHERM_01055500

Standard Name

MRNC46 (Membrane Occupation and Recognition Nexus protein C-terminal)

Aliases

PreTt15304 | 215.m00047 | 3809.m00218

Description

protein with predicted MORN domains localized at the C-terminus of the protein

Genome Browser (Macronucleus)

GBrowse

Genome Browser (Micronucleus)

GBrowse

Gene Ontology Annotations

No Data fetched for Gene Ontology Annotations

Domains

No Data fetched for Domains

Gene Expression Profile

  • Tetrahymena Functional Genomics Database:

TetraMine Data

TTHERM_01055500

WebApollo

Fullscreen View

Tetrahymena Stock Center

No Data fetched for StockID

Homologs (v.2006 protein sequences)

SourceIdentifierScoreDescription
Tetrahymena borealisEI9_20638.19.997093137033517e-262hypothetical protein (430 aa)
OxytrichaContig15620.0.g615.999460549133178e-49MORN repeat
Stentor CoeruleusSteCoe_278631.2995814250075031e-24
DictyBaseDDB_G03494882.9992476920535046e-16DDB_G0349488 on chromosome: 2
position 6912714 to 6914186
WormBaseWBGene000021790.000009999254677478949locus:jph-1 status:Confirmed
UniProt:Q22667 protein_id
:CAA99924.2

General Information

No Data fetched for General Information

Associated Literature

No Data fetched for Associated Literature

Sequences

>TTHERM_01055500(coding)
ATGGGAAACGAGTGTTGTTCGAATTGCAATGTAGGTGGCAAGTAAAGGGAGCTCTAAGAT
AATATAATAAAAGAGACTCCCAATGGGTTGGCTTTAGAAGAAACAAATGGTAAAATCGAA
GATGGAGATACCAATGTATAGAGTTTCTAAGGAAATTAAAAGGTCGTTACTAATTTAGCT
CCAGATTCGAGTTAAAATTTTAGGAAGTCAAGCTTGAATGCTGCTTCTTAACATGAAAGA
CGTCCTTCTTAATAAAGCAATGCGTTTTATGAGAATGGGCATGTAGAAAATGAATTATTA
AACAATAAATAAAAGGATGGAAAGAGACCTTCTGTATTGGATCACTCTTCTTAGAACTAA
CAAGTAGTTAGCGTAAATAGTGCTAGAGCATAAATCAATACTCCTAAATAGAATAGCGAT
GAAGCGATGGTACTTATGCATGGATAAAGCTATAACACTGATTAAGAAATAGAAAGACTA
TTGTCTAAGTTCGATAATACGGATTTAATCAATAAAGATAGAAGCTTCAAAGATATGAGA
CCATCAACAAATGAAGTTTATAAGTTGGATAAAACTGGTGATATTTATGTTGGAGAAACT
CTAAATAAAAAGAGGAACGGATTTGGAAGACTTATTTGCTAAAATGGAAGTTTTTATGAA
GGATATTGGGAAGGAGACAAATTCAATGGATAGGGATTTTATTTAGATAGCGAAGGAAAT
TATATCAAAGGTTAATTCAAAGACAATAAACCTCATGGTCGTTGTCTTCTAAAGAAAAAA
GATGGTGGAATTTACGAAGGCGAAATGAAAAATGGTGAAAAAGATGGTGAAGGAGAAGAA
ACTACTTAGAAGGGTATGACATATAAAGGACATTTTAAGAATGGGTAAATGCATGGAGAA
GGAAAATACTCCATTTCAAATATGTATACTTTTGAAGGATCGTTTGTCAACGATTTCATT
GAAGGATAAGGAAAATGTGTTTGGAAAACAAAGAAGGCATATAATGGTTAATGGCATTAA
AATCGTATGCATGGAAAAGGTGAATTCACATGGCCTGATGGAAAAAGATATACAGGTGAC
TTCTATTAAGATTAATTTGATGGCTATGGCGAGTTTTTATGGTCAAATGGTACTTGCTAT
AAAGGATAGTGGAAGCAAGGTAAAATGCATGGAGCAGGTAAAATTACCACTCCAGAAGGA
AAGGAAATTTCTGGTAACTGGATTAATGGAGAATATTAGCAATAAACCCAAGGAAATTAG
AATGAAAACCAAGTTACTACTTAAAACGAATCAACAAAATGA


>TTHERM_01055500(protein)
MGNECCSNCNVGGKQRELQDNIIKETPNGLALEETNGKIEDGDTNVQSFQGNQKVVTNLA
PDSSQNFRKSSLNAASQHERRPSQQSNAFYENGHVENELLNNKQKDGKRPSVLDHSSQNQ
QVVSVNSARAQINTPKQNSDEAMVLMHGQSYNTDQEIERLLSKFDNTDLINKDRSFKDMR
PSTNEVYKLDKTGDIYVGETLNKKRNGFGRLICQNGSFYEGYWEGDKFNGQGFYLDSEGN
YIKGQFKDNKPHGRCLLKKKDGGIYEGEMKNGEKDGEGEETTQKGMTYKGHFKNGQMHGE
GKYSISNMYTFEGSFVNDFIEGQGKCVWKTKKAYNGQWHQNRMHGKGEFTWPDGKRYTGD
FYQDQFDGYGEFLWSNGTCYKGQWKQGKMHGAGKITTPEGKEISGNWINGEYQQQTQGNQ
NENQVTTQNESTK


>TTHERM_01055500(gene)
ATGGGAAACGAGTGTTGTTCGAATTGCAATGTAGGTGGCAAGTAAAGGGAGCTCTAAGAT
AATATAATAAAAGAGACTCCCAATGGGTTGGCTTTAGAAGAAACAAATGGTAAAATCGAA
GATGGAGATACCAATGTATAGAGTTTCTAAGGAAATTAAAAGGTCGTTACTAATTTAGCT
CCAGATTCGAGTTAAAATTTTAGGAAGTCAAGCTTGAATGCTGCTTCTTAACATGAAAGA
CGTCCTTCTTAATAAAGCAATGCGTTTTATGAGAATGGGCATGTAGAAAATGAATTATTA
AACAATAAATAAAAGGATGGAAAGAGACCTTCTGTATTGGAGTAATTAAATATTATTCAT
GAATTAGTTAATTATATATTTTTGATTCAAAAATGTTCCAATAAAATTTTACTTAGATAG
TATCATTTAGGTTTATTTTAATTCATATCTGTTAATATAACAAAAGTCACTCTTCTTAGA
ACTAACAAGTAGTTAGCGTAAATAGTGCTAGAGCATAAATCAATACTCCTAAATAGAATA
GCGATGAAGCGATGGTACTTATGCATGGATAAAGCTATAACACTGATTAAGAAATAGAAA
GACTATTGTCTAAGTTCGATAATACGGATTTAATCAATAAAGATAGAAGCTTCAAAGATA
TGAGACCATCAACAAATGAAGTTTATAAGTTGGATAAAACTGGTGATATTTATGTTGGAG
AAACTCTAAATAAAAAGAGGAACGGATTTGGAAGACTTATTTGCTAAAATGGAAGTTTTT
ATGAAGGATATTGGGAAGGAGACAAATTCAATGGATAGGGATTTTATTTAGATAGCGAAG
GAAATTATATCAAAGGTTAATTCAAAGACAATAAACCTCATGGTCGTTGTCTTCTAAAGA
AAAAAGATGGTGGAATTTACGAAGGCGAAATGTAAATATTTATTTTATTCATTCCTTTGA
AAATCAATCTAAATTTTTTACACCAGTTAAAATGCTTTGAAATGAATTTTAATTATTTAG
ATTCGTTATGTATGCAATTATTTAGCTTATTTATTTATATATTTACAATTTATAGTAAAA
TCATTTTTAATCAATTAAATAAAGAATAAGTGATTCATTTATTTATTTATTATTTAGTAC
TGACTGGAAAAATAATTTATTTTAATATTTTATAAAAATTAATTTAAAATAACTTTATTA
AATTTTATAGGAAAAATGGTGAAAAAGATGGTGAAGGAGAAGAAACTACTTAGAAGGGTA
TGACATATAAAGGACATTTTAAGAATGGGTAAATGCATGGAGAAGGAAAATACTCCATTT
CAAATATGTATACTTTTGAAGGATCGTTTGTCAACGATTTCATTGAAGGATAAGGAAAAT
GTGTTTGGAAAACAAAGAAGGCATATAATGGTTAATGGCATTAAAATCGTATGCATGGAA
AAGGTGAATTCACATGGCCTGATGGAAAAAGATATACAGGTAAACTATTTTTTTATCATA
AATGATTATTTTGTTTAATCTTGTTTCAATATTTGTTTATTTAGGTGACTTCTATTAAGA
TTAATTTGATGGCTATGGCGAGTTTTTATGGTCAAATGGTACTTGCTATAAAGGATAGTG
GAAGCAAGGTAAAATGCATGGAGCAGGTAAAATTACCACTCCAGAAGGAAAGGAAATTTC
TGGTAACTGGATTAATGGAGAATATTAGCAATAAACCCAAGGAAATTAGAATGAAAACCA
AGTTACTACTTAAAACGAATCAACAAAATGA