Identifiers and Description

Gene Model Identifier

TTHERM_00590130

Standard Name

MRNC39 (Membrane Occupation and Recognition Nexus protein C-terminal)

Aliases

PreTt24128 | 81.m00185 | p38 | 3726.m00061 | PHP2

Description

protein with predicted MORN domains localized at the C-terminus of the protein

Genome Browser (Macronucleus)

GBrowse

Genome Browser (Micronucleus)

GBrowse

Gene Ontology Annotations

No Data fetched for Gene Ontology Annotations

Domains

Gene Expression Profile

  • Tetrahymena Functional Genomics Database:

Change in Gene Expression

TMHMM

TMHMM

Signal Peptide

Signal Peptide Present?: No
Presense Probability: 10.2%

TetraMine Data

TTHERM_00590130

WebApollo

Fullscreen View

Tetrahymena Stock Center

No Data fetched for StockID

Homologs (v.2006 protein sequences)

SourceIdentifierScoreDescription
Tetrahymena borealisEI9_16957.19.997093137033517e-262hypothetical protein (426 aa)
OxytrichaContig13677.0.1.g359.997962730346853e-122MORN repeat
Stentor CoeruleusSteCoe_122701.1379798735078682e-50
DictyBaseDDB_G03494882.0004286606204839e-16DDB_G0349488 on chromosome: 2
position 6912714 to 6914186
WormBaseWBGene000021790.000000030002053728821195locus:jph-1 status:Confirmed
UniProt:Q22667 protein_id
:CAA99924.2

General Information

No Data fetched for General Information

Associated Literature

  1. Ref:10187773: Nakashima S, Wang S, Hisamoto N, Sakai H, Andoh M, Matsumoto K, Nozawa Y (1999) Molecular cloning and expression of a stress-responsive mitogen-activated protein kinase-related kinase from Tetrahymena cells. The Journal of biological chemistry 274(15):9976-83

Sequences

>TTHERM_00590130(coding)
ATGGGTTGCTGTTAATCTGAACAATAAAAGGTAGAAGGCCTAAGCGCCAACAGAACTGAA
GCAATGGGCAATAATTTCACTTCTGAAGAGGCTGGAGAAACCAACTAAACAACAGTAGGA
AATACAAAGAAGCCCTAGGTCCATGCTATGGTAAATGAAGAAGAGAATTAACAAAGATCT
ATGGAATCATAATCAAATCTTAAAGTTGAATAAGAAGCTGCTAAGATAGTTTCAAGAACT
GAAATTAACTAATAAGCTAATTCAGATAAAACCATTCATATGCCTTCAACTAAATTCGCC
ACTACAATAGATACTGAACCTGATTATACCAATAATGCCACCAAAAACACTTTACAAAAA
TGCGGTGACTTTATTTATGATTGTCCTTAATACGATGATGCTGAAGCTGTTGAATTAGGT
TTATACCAATTAGAAAACGGATCAGTCTATAAAGGTCAATGGAAAAATGGTATGAGACAT
GGTAGAGGTAAATAACTCTGGAAGGATGGATCTATTTATGAAGGATACTGGAAAAACAAC
ATGGCTCATGGCAAGGGTAGACTTATTCACTCCGACGCTGATGTTTATGAGGGTGAATGG
AAAAATGATAAGGCTGATGGATACGGTACATATACTCATGCTGACGGTGCTAAGTATATT
GGTAACTGGGTTGATGATAAGTAAGAAGGTCACGGTATAGAAATCTGGCCTGATGGTGCC
AAGTATGAAGGACAATACGTTCAAGGTAAGAAATAAGGAAAGGGTAAATTCTTCTGGACT
GACGGCTCATAATACGAAGGACAATTCTAAAACAACAACATTCATGGTTTCGGTACTTAC
ACATGGGCTGATGGAAGAAACTACAAGGGTGAATGGAAGAATAATAAAATGGACGGTCAA
GGAGAATTTAGATGGCCTGATGAAAGAAAATATATTGGAAGCTATGTAGAAGATAAAAAG
CACGGATACGGTGAATTCGAATGGCCTGATGGCAGAAAATATAAAGGATAATGGTTTAAT
GGCAAATAACATGGTCAAGGTGTCTATATTAATGCTCAAGGTAAAGAAAAGAACGGAGAA
TGGGCTGATGGTAAAAGAATTAAATGGACAAACGAAGACGGTGAAAATTGA


>TTHERM_00590130(protein)
MGCCQSEQQKVEGLSANRTEAMGNNFTSEEAGETNQTTVGNTKKPQVHAMVNEEENQQRS
MESQSNLKVEQEAAKIVSRTEINQQANSDKTIHMPSTKFATTIDTEPDYTNNATKNTLQK
CGDFIYDCPQYDDAEAVELGLYQLENGSVYKGQWKNGMRHGRGKQLWKDGSIYEGYWKNN
MAHGKGRLIHSDADVYEGEWKNDKADGYGTYTHADGAKYIGNWVDDKQEGHGIEIWPDGA
KYEGQYVQGKKQGKGKFFWTDGSQYEGQFQNNNIHGFGTYTWADGRNYKGEWKNNKMDGQ
GEFRWPDERKYIGSYVEDKKHGYGEFEWPDGRKYKGQWFNGKQHGQGVYINAQGKEKNGE
WADGKRIKWTNEDGEN


>TTHERM_00590130(gene)
GCGAAACAAGAAATAGGTATTGAATTGAATGTAGTTTTGAAAGATCAGCAAAATAAATAA
ATAAATTAATATAAACAAATAAACTCAGAATAAGAAGAAAGAATAAGAAACCTTTTATCA
TAAATAATATCATCAAACAAACAAAAAATAAAAGAAGTAATAAAAATAAAAAATAATTCA
AGTTAAAAATTTTAGTATCATAGGAAAGATAATAATTATATGGGTTGCTGTTAATCTGAA
CAATAAAAGGTAGAAGGCCTAAGCGCCAACAGAACTGAAGCAATGGGCAATAATTTCACT
TCTGAAGAGGCTGGAGAAACCAACTAAACAACAGTAGGAAATACAAAGAAGCCCTAGGTC
CATGCTATGGTAAATGAAGAAGAGAATTAACAAAGATCTATGGAATCATAATCAAATCTT
AAAGTTGAATAAGAAGCTGCTAAGATAGTTTCAAGAACTGAAATTAACTAATAAGCTAAT
TCAGATAAAACCATTCATATGCCTTCAACTAAATTCGCCACTACAATAGATACTGAACCT
GATTATACCAATAATGCCACCAAAAACACTTTACAAAAATGCGGTGACTTTATTTATGAT
TGTCCTTAATACGATGATGCTGAAGCTGTTGAATTAGGTTTATACCAATTAGAAAACGGA
TCAGTCTATAAAGGTCAATGGAAAAATGGTATGAGACATGGTAGAGGTAAATAACTCTGG
AAGGATGGATCTATTTATGAAGGATACTGGAAAAACAACATGGCTCATGGCAAGGGTAGA
CTTATTCACTCCGACGCTGATGGTAAATATAACTAACTAACTAGCTAATCAACTAATAAA
TTATCAAAAAAAAAAAATACTATTTTTTCTTTTAAATGAAAACAATTACTTCCTTTTTAA
AATATATCTATAACTATGATCGAATTAAATTTTATAAAACTAACTTTTGCCAAGAGTAAT
TTTAAATCCTCCATTGATTCATAAAGGCTCTTTCAAGCACCCAAAATTACTTATTATTAA
AGTTTTTTCAGATGAATTAAAACGCTGTTTGGCTATCATTTTTTAGCTCAATTTTGTAAT
TCGGGAATATTTAGTTAAAAATTGCGTTTTTTATTTTTAAAAATTTTCTTTATATATCTA
TTTATCTTACTATAATTTTTCTTAATTAAAGTTTATGAGGGTGAATGGAAAAATGATAAG
GCTGATGGATACGGTACATATACTCATGCTGACGGTGCTAAGTATATTGGTAACTGGGTT
GATGATAAGTAAGAAGGTCACGGTATAGAAATCTGGCCTGATGGTGCCAAGTATGAAGGA
CAATACGTTCAAGGTAAATAAAACCACTTTAATAAAATTAAATCTTGTTTGCGCTATCAC
TTCCAAAAATAAATAAGGGAATATTTATCATTTTTTTGTAAATTTACCCCATATATTAGC
ATAAAGCACCAAAGTGAAAGTTGAAAAATTTCAATAAAATTAGCGCTAATTATACAACTT
ATATTTGATATTAAATTTATGATAGAAGCTTTTTCAAACAGTATTTGTACTTTCTAAGTA
AGATATTCAAAAATAAATAAACTCACTAGTTTAATTTTGCTAGAATTTGATTTAGAAAAA
ATAAATCAATAACTTTGAGTTGCAAAATTTGTTTTAATCAATAAGAAATTTTTAAATTTT
AGAACGATTTTGTCTTCTATCTATCTATTTATTATTTGCAATAGAAAATAAAATTAACTA
ATCTCATCAACTATTCAATAAATTTAAAAAGGTAAGAAATAAGGAAAGGGTAAATTCTTC
TGGACTGACGGCTCATAATACGAAGGACAATTCTAAAACAACAACATTCATGGTTTCGGT
ACTTACACATGGGCTGATGGAAGAAACTACAAGGGTGAATGGAAGAATAATAAAATGGAC
GGTCAAGGAGAATTTAGATGGCCTGGTAAATAATTAAATAAATAAATATTAATATAGATA
TCATTGAATATTTCTCTTTTTTTCATTTGCTGTTTGAATATATAAATCTTATCATTATTA
AATTAACTTATAAAGATGAAAGAAAATATATTGGAAGCTATGTAGAAGATAAAAAGCACG
GATACGGTGAATTCGAATGGCCTGATGGCAGAAAATATAAAGGATAATGGTTTAATGGCA
AATAAGTAATTGAATGAATATTTTTAAAGTTAAACAAATGATTAATTAATATAATTTAAA
AATTAATTAGCATGGTCAAGGTGTCTATATTAATGCTCAAGGTAAAGAAAAGAACGGAGA
ATGGGCTGATGGTAAAAGAATTAAATGGACAAACGAAGACGGTGAAAATTGA